KEGG   Mus musculus (house mouse): 228366
Entry
228366            CDS       T01002                                 
Symbol
Large2, 5730485C17Rik, AI891893, Gyltl1b, Largel, mKIAA4105
Name
(RefSeq) LARGE xylosyl- and glucuronyltransferase 2
  KO
K09668  glycosyltransferase-like protein LARGE [EC:2.4.2.- 2.4.1.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00515  Mannose type O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    228366 (Large2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    228366 (Large2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     228366 (Large2)
   2.4.2  Pentosyltransferases
    2.4.2.-
     228366 (Large2)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   228366 (Large2)
SSDB
Motif
Pfam: Glyco_transf_49 Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 228366
NCBI-ProteinID: NP_766258
MGI: 2443769
Ensembl: ENSMUSG00000040434
UniProt: Q5XPT3
Position
2:complement(92195391..92201437)
AA seq 690 aa
MLPRGRPRAMGAAVLLLLLLLVVGFFLFGRDPDYGLGTTATLDEDPYRSRNLSASSPQLL
LPPKCEMLHVAIVCAGYNSSREIITLTKSLLFYRKNPLHLHLITDAVARNILETLFRTWM
VPAVVVSFYDAEELKPLVSWIPNKHYSGLYGLMKLVLPSILPPSLARVIVLDTDVTFSSD
IVELWALFDHFSDKQVVGLVENQSDWYLGNLWKNHRPWPALGRGFNTGVILLWLDRLQQT
GWEQMWKVTAKRELLTLMATSLADQDIFNAVIKEHPHLVHPLPCVWNVQLSDHTRAERCY
LEAADLKVIHWNSPKKLRVKNKHAEFFRNLHLTFLGYDGKLLRRELFGCPNQFPPGAEQL
QQALTQLDEEEPCFEFRQQQLTVHRVHITFLPHQPPPPQPHDVTLVAQLSMDRLQMLEAL
CRHWPGPMSLALYLTDEEAQQFLHFVETSPVLSMRKDVAYHVVYRDGPLYPVNQLRNVAL
AQALTPYVFLSDIDFLPAYSLYDYLRASIEQLELDSRRKTALVVPAFETLHYRFSFPNSK
AELLTLLDAGSLHTFRYHEWPQGHSSTDYSRWREAQAPYSVQWSADYEPYVVVPRDCPRY
DPRFVGFGWNKVAHIIELDAQEYEFLVLPEAFSIHLPHAPSLDISRFRSSPTYRNCLQAL
KEEFHQDLSRRYGSAALKYLTALQQARSRA
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgctgccccgaggtcgcccccgggcaatgggggccgccgtgctgctgctgctgctgttg
ctagtggttggcttcttcctgttcggccgggacccggattatggactgggcacaactgct
accctcgatgaagacccgtacaggagtcgcaacctctccgcctccagcccgcagcttcta
ctgccacccaagtgcgagatgttgcatgtggctatcgtgtgtgcgggatacaactccagc
cgagagattattaccctaacgaagtccctgctattctacaggaaaaatccgctgcacctc
cacctgataactgatgccgtagccagaaacatcctggagacactcttccgaacatggatg
gtgccagcggtggtggtcagcttctatgatgcggaagaactcaagcccctggtctcctgg
atccccaacaaacactactctggcctctatgggctaatgaagctagtacttcccagcatc
ctgcctcccagcctggcccgagtcatcgtcctggataccgacgtcactttctcctctgac
attgtggagctctgggcactctttgatcatttttctgacaagcaggtggtcggtctcgtg
gagaaccagagcgactggtacctgggcaacctctggaagaaccataggccctggcctgcc
ttgggcaggggatttaacacaggtgtgatcctgctgtggctggacaggctccagcaaact
ggctgggagcagatgtggaaggtgacagccaaacgagagctgctcactctgatggctact
tccttggctgaccaggacatcttcaatgcggtcatcaaggagcacccccatctggtgcac
cccctgccctgtgtctggaacgtgcagctgtcagaccacactcgggctgagcgctgctac
ctggaagcagctgacctcaaagtgatccactggaattcaccaaagaagcttcgagtgaag
aacaagcacgcagaattcttccgtaatctgcacttgacctttctggggtatgatgggaag
ctactgcgaagagagctctttggatgccccaaccagttccctcctggggccgagcagttg
caacaggccctaacacagctggatgaggaagagccctgctttgagttccgccaacagcag
ctcactgtgcaccgggtgcacatcaccttcctgccccaccagccgccacctccccagcct
cacgatgtcaccttggtggcccaactctctatggaccggctgcagatgctggaagccctg
tgcaggcactggccaggccccatgagcctggccttgtacctgacagatgaagaggctcaa
caatttcttcattttgtggaaacgtcgccagtgctctctatgaggaaggatgtggcctac
catgtagtgtaccgggacggtccactctatccagtcaaccagctccgcaacgtggccttg
gcccaggctctcacaccctacgtcttcctcagtgatattgacttcttacctgcctactcc
ctctacgactacctcagggcttctatcgagcagctggagctggacagtcggcgcaagact
gctttggtggtgcctgcatttgagaccctacactaccggttcagcttcccaaactctaag
gcagagctgttgacgttactggatgccggctcccttcacacctttaggtaccacgagtgg
ccacagggtcactcatccacagactattcccgctggcgggaagcccaggcaccatacagt
gtgcagtggtcagctgactatgaaccctacgtggtggtaccccgtgactgcccccgttat
gatcctcgctttgtgggatttggctggaacaaggtggcccacatcatagagttggatgct
caggaatatgaattcctggtacttcctgaggccttctctatccacttgccccacgctcca
agtcttgacatctcccgcttccgctccagccccacctaccgcaactgtctccaggccctc
aaggaagagttccaccaggacttgtcaaggcgctatgggtctgcagccctgaaatacctc
actgccctgcagcaggcccgaagtcgggcctga

DBGET integrated database retrieval system