KEGG   Mus musculus (house mouse): 228421
Entry
228421            CDS       T01002                                 
Symbol
Kif18a, AU024633, B130001M12Rik, gcd2
Name
(RefSeq) kinesin family member 18A
  KO
K10401  kinesin family member 18/19
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    228421 (Kif18a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     228421 (Kif18a)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF2443
Other DBs
NCBI-GeneID: 228421
NCBI-ProteinID: NP_647464
MGI: 2446977
Ensembl: ENSMUSG00000027115
UniProt: Q91WD7
Position
2:109111083..109172094
AA seq 886 aa
MSGTEEDLCHRMKVVVRVRPENTKEKAVQFCKVVHVVDKHILSFDPKQEEISFFHRKKTT
NFDITKRQNKDLKFVFDAVFDETSTQMEVFEHTTKPILHSFLNGYNCTVFAYGATGSGKT
HTMLGSAAEPGVMYLTMLDLFKCIDEIKEEKECSTAVSYLEVYNEQIRDLLTNSGPLAVR
EDSQKGVVVQGLTLHQPKSSEEILQLLDNGNKNRTQHPTDVNAVSSRSHAVFQIYLRQQD
KTASINQNVRIAKMSLIDLAGSERASVSGAKGSRFVEGTNINKSLLALGNVINALANTKR
RNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSLFYDDTYNTLKYANRAKEIKSSLK
SNVLNLNSHISQYVKICNMQKAEILMLKEKLKAYEEQKALSDRNDCAKLVHSNPEDRETE
RFQEILNCLFQNREGIRQEYLKLEMLLKANALKSSYHQQCHKQIEMMCSEDKVEKATCKR
DHRLEKLKTNSCFLEKKKEEVSKQFDENTNWLHRVENEMRLLGQNGDIPEALNKELHCHH
LHLQNKELKTQMAHMTALACLQEQQHKQTEAVLNALLPVLRKQYWKLKETGLSNAAFDSD
FKDIEHLVERKKVVAWADQTNEHSNRNDLPGISLLMTFPQLEPIQSISCCTSVSDPNVLK
LTPQRRTRRKIIPSPLKVQHTQKSALSESTQLNDSFSKELQPIVYTPEDCKKAQDLFPSL
TRTSSQSANVMNDNSQKALCRIESPLSRTECKQGLYSTSTLCDSIRGLKNKWPEQEPLAS
SKSSVHRIESSSFSTKDSMPESAGVPSYMAMTTAAKRKWKQMSSTSNASIKSDESCGFAK
RIRRDNSSVKPMQENRLKVGYKRNTNKTNSNMLRKFRRNTSKENVQ
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgtctggcactgaagaagacttatgtcaccgcatgaaagtagttgtccgtgtacgtcct
gagaacacaaaagaaaaggcggtgcagttctgtaaagtggttcatgtagtggataaacat
atactcagttttgatccgaaacaagaagaaatcagtttttttcacagaaagaaaactaca
aattttgatattactaaaaggcaaaataaagatctgaagtttgtatttgatgctgtcttt
gatgaaacttcaactcaaatggaagtttttgaacacacaaccaagccaatccttcatagt
tttctgaatggatacaattgcacagtatttgcatatggtgccactggatctgggaaaact
cacacaatgctaggatcagctgctgaacctggggtcatgtacctgacaatgctggacctt
ttcaaatgcatcgatgagattaaagaagagaaagagtgtagcactgccgtgtcatacctg
gaggtatataatgaacagatccgtgacctcttgacaaactcaggaccacttgctgtccgg
gaagattcccaaaaaggagtggttgttcagggtcttactctacaccagcctaaatcttca
gaggaaatattacagctactagacaatggaaacaaaaacaggacccagcatcccactgac
gtgaatgcagtgtcttctcgttcccatgctgttttccagatttatttgcgacaacaagac
aaaacagcgagcatcaatcaaaatgtccgtatagccaaaatgtcactcatcgacctcgca
ggatctgagagggccagtgtttcgggtgctaaagggtcacgatttgtagaaggcacaaat
attaacaaatctcttttagctcttgggaatgtcatcaatgccttagcaaatacaaagaga
agaaatcagcatattccttacagaaatagtaagcttactcgtttgctgaaggattctctt
ggaggaaactgtcaaactataatgatagctgctgttagtccttcctctttattttatgat
gacacatataacactcttaagtatgctaatcgtgcaaaggaaattaaatcttctttgaag
agcaatgttcttaatctcaacagtcacatatctcagtatgtaaagatatgtaatatgcag
aaagcagagattttaatgttgaaagaaaaactaaaggcctatgaagaacagaaagccctg
tctgacagaaatgactgtgctaaattagtacattcaaacccagaagacagagaaactgaa
agatttcaagaaattctgaactgcttgttccagaatcgagaaggaatcaggcaagagtat
ctgaagttagaaatgttacttaaggcaaatgcgctaaagtcatcctatcaccaacagtgc
cataaacagatagagatgatgtgttctgaagacaaagtggaaaaggccacttgcaaacga
gatcacagacttgaaaagttgaaaaccaacagctgttttctagagaaaaagaaagaagag
gtgtcgaaacaatttgatgaaaatactaattggctacatcgtgttgaaaacgaaatgcga
ctcttgggtcaaaatggtgatattccagaggcactcaataaagagcttcactgtcaccat
ttacacctccagaacaaagaactgaaaacacaaatggcacacatgacagctctagcttgt
ctccaggaacagcagcacaagcaaactgaggcagtattgaatgctttgcttccagtacta
agaaaacagtattggaaattgaaagaaactggcctgtcaaatgctgcttttgattctgac
ttcaaagatattgaacatttagtagagagaaaaaaggtggtggcttgggctgaccaaact
aatgaacattcaaaccgaaatgatcttccagggatttctcttcttatgaccttcccacag
cttgaaccaattcagtctatttcttgttgcacatctgtgagtgatcctaacgtgcttaaa
cttactccacaacgaagaaccagaagaaaaataattccttctcccttgaaagtacaacat
actcagaagtctgcactgtctgaaagtacacagctcaatgattctttcagcaaagaactt
cagcctattgtttatacgccagaggactgcaaaaaagctcaagacctgtttccatcctta
acgagaacttcatcgcagtctgcaaatgtaatgaatgacaattcccagaaagcactgtgt
agaatagagtctcctctcagcagaactgagtgcaaacagggtttgtactctacatctact
ctgtgtgatagcatcagaggcttgaagaataaatggcctgaacaagaaccactagcaagc
agcaaaagcagtgtgcacaggatagagtcttcttcattttcaacaaaggattctatgcct
gaatcagcaggtgtgccgtcctacatggcaatgactactgctgcaaagaggaaatggaaa
caaatgagttctacatcaaatgcttcaatcaaatctgatgaaagttgtggatttgccaaa
cgcattcgacgggataattcaagcgttaagcctatgcaagaaaacagactgaaagtgggc
tataaaagaaataccaacaaaacaaattcaaacatgcttagaaaatttagaagaaacact
tcaaaagaaaatgtacaataa

DBGET integrated database retrieval system