KEGG   Mus musculus (mouse): 228491
Entry
228491            CDS       T01002                                 

Symbol
Zfp770, 6430601A21Rik, Znf770
Name
(RefSeq) zinc finger protein 770
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-MYST
Other DBs
NCBI-GeneID: 228491
NCBI-ProteinID: NP_780675
MGI: 2445100
Ensembl: ENSMUSG00000040321
Vega: OTTMUSG00000015214
UniProt: Q8BIQ8
Position
2; 2 E4
AA seq 705 aa
MPLRNVMAENNFKMLKIQQCVANKLPRNRPYICNICFKHFETPSKLARHYLIHTGQKPFE
CDVCHKNFRQLVHLERHQLTHNLPFSCNICQRHFKNLKTFVKHQQLHNESYHNDVKVRRL
LETKQEKPVYGMCNTFTADERWALHPCSKSDATYSTTKRRKNIHACTICGKMFPSQSKLD
RHSLIHTGQRPFKCVLCSKSFRQSTHLKIHQLTHSEERPFQCCFCQKGFKIQSKLLKHKQ
IHTRNKTLQNLPLKVKSPESCPLPNKLNAKQDAFESGDMGESEENNPLDVHSIYIVPFQC
SECEECFESEQILNGHKCLPARGGRVPSRLKRSCNYKTIVKKLLAKLKRAGGKKSDDLQS
EKKRTFKSNYLKNCERSSGKPNIEQTQRTFVGSLSRHGSYKTVSKKKKKTLALPFSWQKQ
FQSQNTGKSLQGILTTGSILSMDGSVNNKDLSIYGSSGEEYLNCDMLQCGFSDSSENIHT
GHKMCPCDKCDKVFPSISKLQRHYLIHTGQRPFDCNVCGKSFRQSAHLKRHKLTHIEKIP
YSSFWRVDFGNVNQLFIHPSDDVSYNASQQCEGLGSQSCESSESSQVSEIEVKVEPEDFL
LGSHCRSRQSYLANALVESEQSHHCYSYLGRPERSDGLLYQCSVCCKHFRSPSKLERHYL
IHAGQKPFECSVCGKTFRQAPHWKRHQLTHFKERPQEKVVLDSTV
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgccactgaggaatgtgatggctgaaaacaactttaaaatgctgaagattcagcaatgt
gtagccaacaaactacctaggaacaggccatatatttgcaatatctgcttcaagcacttt
gaaacaccatcaaaattagctaggcattatctcattcataccggtcaaaagccatttgaa
tgtgatgtgtgccataaaaactttagacaactcgttcatctggagaggcatcagttaact
cacaatctgcctttcagttgtaatatttgccaacgccactttaaaaatttgaagacattt
gtgaagcatcaacagcttcacaatgaatcctaccataatgatgttaaagtcagaagactg
cttgagaccaagcaagagaagccggtatatggaatgtgtaatacttttactgcagatgag
agatgggcactacacccatgctctaagtctgatgccacatacagcaccacgaagagaaga
aagaatatccacgcgtgtacgatctgtggcaaaatgtttccgtcacaatcaaaacttgat
aggcactcacttattcacaccgggcagaggccttttaaatgtgtcctgtgcagtaaatct
ttccgacagtcaacccacttaaaaatccaccaactcacacattcagaagaaagacctttt
caatgttgtttttgtcaaaaaggatttaagattcaaagcaaacttctgaagcataagcaa
atccacactaggaataagactcttcagaatcttcctttaaaagtaaaaagtcctgagtca
tgtcccctacctaataaattaaacgcaaagcaggatgcttttgaaagtggtgatatgggt
gaatctgaggagaataatcctcttgatgtccactcaatttacattgtcccttttcagtgt
tcggagtgtgaagaatgttttgagtcagagcagattctcaatggacacaagtgtcttcct
gccagaggtggcagagttccaagcagactcaaaagaagctgtaactataagaccattgtt
aaaaagctcttggctaaacttaaacgtgctgggggtaaaaaatcagatgatcttcagtca
gagaagaagagaacatttaaaagcaactacctgaaaaattgtgaacgctcttctggtaag
ccgaacatagaacaaactcagagaacatttgtgggttctcttagcagacatggttcatac
aagacagttagcaaaaagaagaagaaaactctggctttgccattttcttggcaaaagcaa
ttccagagccaaaatacgggtaagagtttgcaaggcatccttacaacgggaagcatatta
tctatggatggttccgtcaataataaagacttgtcaatctatggttcgtcaggtgaggaa
tacttaaactgtgacatgcttcagtgtggtttttcagattcaagtgaaaatatacatact
ggacataagatgtgtccctgtgataaatgtgacaaagtgtttccttctatttctaagcta
caaaggcactatttaattcatactggacagagacctttcgactgtaatgtttgtggaaaa
tctttcagacagtcagctcacttaaaaaggcataaactaactcatattgaaaagattcct
tacagttctttttggcgagtggactttggaaatgtgaaccaacttttcatccatccaagt
gatgatgttagctataatgcctcccaacagtgcgaggggcttggttcccaaagctgtgaa
agttcagagtccagtcaggtatcagaaattgaagtcaaggtagaaccagaggattttctt
cttggttcccactgtaggagcaggcagtcttacctcgccaacgcactggtggagtcagag
cagagccatcattgttacagttacttaggccgtcctgaaagaagtgacgggctcctttac
cagtgcagtgtttgttgtaaacatttccgatctccgtccaaactagaaagacactattta
attcatgcagggcagaagccatttgagtgctcagtctgtggtaaaacatttagacaagca
cctcattggaagagacatcagctcactcactttaaggagcgacctcaagagaaagtggtt
ctagactcaactgtgtaa

DBGET integrated database retrieval system