KEGG   Mus musculus (mouse): 228543Help
Entry
228543            CDS       T01002                                 

Gene name
Rhov, A030005A06Rik, Arhv
Definition
(RefSeq) ras homolog family member V
  KO
K07866  Ras homolog gene family, member V
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    228543 (Rhov)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    228543 (Rhov)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    228543 (Rhov)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    228543 (Rhov)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 AAA_25
Motif
Other DBs
NCBI-GeneID: 228543
NCBI-ProteinID: NP_663505
MGI: 2444227
Ensembl: ENSMUSG00000034226
Vega: OTTMUSG00000015878
UniProt: Q8VDU1
Position
2; 2 E5
AA seq 236 aa AA seqDB search
MPPRELSEAEPPPLPASTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARY
RPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQN
ITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRA
CCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcgggagctaagcgaggccgagccaccgcctctcccggcctcgacccctcct
ccgcggcggcgcagcgcccctccggagctgggcatcaaatgcgtgctggtgggcgatggc
gcggtgggcaagagcagcctcatcgtcagctacacctgcaatgggtaccccgcgcgctat
cggcctacagcactagacaccttctccgtgcaagtcctggtcgatggagcccctgtgcga
atcgagctttgggacaccgcagggcaggaggactttgaccggcttcgttctctctgctac
ccggacaccgatgtctttctggcttgcttcagcgtggtgcagcccagctccttccaaaac
ataacagaaaaatggctgcctgagatccgcactcacaacccccaagcacccgtgttgctg
gtgggcactcaggctgacctaagggacgatgtcaatgtactaattcagttggaccaagga
ggccgggagggcccagtaccacaaccccaagcccagggtctggctgagaagatccgcgcc
tgctgctaccttgagtgctcggccttgacgcagaagaacttgaaggaggtgttcgactcg
gccattctcagtgcgattgagcacaaagcccgtctggagaagaaactgaacgcaaaaggt
gtgcgcacgctgtctcgctgtcgctggaagaagttcttctgctttgtgtga

DBGET integrated database retrieval system