KEGG   Mus musculus (mouse): 228545Help
Entry
228545            CDS       T01002                                 

Gene name
Vps18, 9930024E13Rik
Definition
(RefSeq) VPS18 CORVET/HOPS core subunit
  KO
K20181  vacuolar protein sorting-associated protein 18
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    228545 (Vps18)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    228545 (Vps18)
   Hops complex
    228545 (Vps18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep3_Vps18 Clathrin Zn_ribbon_17 zf-C3HC4_2 zf-RING_5 Vps39_2 zf-RING_2 zf-RING_UBOX zf-ANAPC11 KNOX2 zf-rbx1 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 228545
NCBI-ProteinID: NP_758473
MGI: 2443626
Ensembl: ENSMUSG00000034216
Vega: OTTMUSG00000015944
UniProt: Q8R307
Position
2; 2 E5
AA seq 973 aa AA seqDB search
MASILDEYEDSLSRSAVLQTGCPSVGIPHSGYVSAHLEKEVPIFTKQRVDFTPSERITSL
VVSCNQLCMSLGKDTLLRIDLGKASEPNRVELGRKDDAKVHKMFLDHTGSHLLVALSSTE
VLYMNRNGQKARPLARWKGQLVESVGWNKAMGNESSTGPILVGTAQGQIFEAELSASEGG
LFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRGFVIATTRQRLFQFIGRAVEDTE
AQGFAGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGSLDCG
RPDSLLSEERVWEYPAGVGPGANPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFL
EKFGPLRHMVKDSSTGHLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPD
CLDTVLAREADFCFRQHRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLAGL
KPTERTQATLLTTWLTELYLSRLGALQGDPDALTLYRDTRECFRTFLSSPRHKEWLFASR
ASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSP
ILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEAQQVSQAIRYMEFCVNVLGETE
QAIHNYLLSLYARGQPASLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVL
ELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASC
PLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQEL
RGRYGTVEPQDKCSTCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQR
KLGAAPPPTKGSVKAKEAEAGAAAVGPSREQLKADLDELVAAECVYCGELMIRSIDRPFI
DPQRYEEEHLSWL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatcctggatgagtacgaggactcattgtcccgctcggccgtcttgcagact
ggttgccctagcgtgggcatcccccattctgggtatgtaagtgcccacctggagaaggag
gtgcccatcttcaccaagcagcgggttgacttcaccccctcggagcggatcactagcctc
gtggtctcctgcaatcagctctgcatgagcctgggcaaggatacactgctccgcattgac
ttgggcaaggcaagtgagcccaaccgtgtggaactggggcgcaaggacgacgccaaagtc
cacaagatgttcctggaccatactggctctcatctgctggttgcgctgagtagcaccgag
gtcctttacatgaaccgcaatggacagaaggcccggcccctggctcgctggaagggacag
ctggtggagagtgtgggatggaacaaggccatgggcaacgagagcagcaccggccccatc
ctggtcggcacagctcaaggacagatctttgaagcagagctctcagctagcgagggtggc
ctctttggccctgccccagatctctacttccgtccactgtatgtgttaaatgaagaaggg
ggtccagcccctgtgtgctccctcgaggctgagcgtggccccgatggccgaggctttgtc
attgccaccactcggcagcgcctcttccagttcataggccgagctgtggaagatactgaa
gcccagggcttcgcaggactctttgctgcctatacagaccacccgcccccattccgtgag
tttcctagcaatttggggtatagtgagttggctttctatacccctaagttacgctcggca
cctcgcgcctttgcctggatgatgggagatggagtgctgtatggctcactggactgcggg
cgtcctgactcgctgctgagtgaggagcgagtgtgggaatacccagcgggggttggtcct
ggggccaatccacccttagccatcgtcctgacccagttccatttcctactgctgctggcc
gaccgggtggaggctgtgtgcacgctaacagggcaggtggtgctacgggatcacttcctg
gagaagtttggaccactgaggcacatggtgaaggactcatccacaggccacctatgggcc
tacactgagcgtgcggtcttccgctaccatgtgcaacgtgaggcacgggatgtctggcgc
acctacttggacatgaaccgctttgacctggccaaagagtattgtagagagcggcctgat
tgcctggacacggtcctggcccgagaggctgatttctgttttcgtcagcatcgctacctg
gagagcgcccgctgctacgcgctgacccagagctattttgaggagattgccctcaagttc
ttggaggcccggcaagaggaggcgctggccgagtttcttcagcggaaactggccggcttg
aagccgacggagcgtacccaggccacactgctgaccacttggctgacagagctctacctg
agccgcctgggtgctctgcagggtgacccagatgctctgactctctaccgggacacacgg
gagtgtttccgtacttttctcagtagccctcggcacaaagagtggctctttgccagccgg
gcctctatccacgagctgctcgccagtcacggagacacagagcacatggtgtattttgca
gtgatcatgcaggactatgaacgggtggtcgcataccactgccagcatgaggcttacgag
gaggccctggctgtgcttgcccgccaccgggacccccagctcttctacaaattctccccc
attctcatccgccacatcccccgccagctcgtagacgcctggattgagatgggcagccgg
ctggatgctcggcagctcatccctgccctggtgaactacagccagggcggtgaggcccag
caggtgagccaggccatccgctacatggaattctgcgtgaatgtgctcggtgagacggag
caggccattcacaactacctgctgtccctgtatgcccgtggccagccagcctcacttctg
gcatacctggaacaagctggggccagcccgcaccgtgtacattatgatctcaaatatgca
cttcgactttgtgctgagcacggccaccaccgcgcctgcgtccatgtctataaggtgttg
gagctatatgaggaggctgtggacctggccctgcaggtggatgtggacctggccaagcag
tgtgcagacttgccggaggaggatgaggaacttcgcaagaaactatggctcaagatcgcc
cggcacgtggtgcaggaggaagaagacgtccagacagccatggcctgcttggccagctgc
cccttgctcaagatcgaggatgtgctgcccttcttccctgactttgtcaccatcgaccac
ttcaaggaggcaatctgtagttccctgaaggcctacaaccaccacatccaggagctgcag
cgcgagatggaagaagccacagccagtgcccagcgcatccgacgagacttgcaggagctc
cgaggccgctatggcaccgtggagccccaggacaaatgctccacctgtgactttcctttg
ctcaaccgacccttttacctgtttctctgtggccacatgtttcacgctgactgtctccta
caggctgtgcggcccggcctccctgcctacaagcaggccagacttgaggaactgcagcgc
aagcttggggcggcgcctcctccgaccaaaggctccgtgaaggccaaggaggcagaagct
ggggctgcagcggtggggcccagtcgggagcagctcaaggctgacctggatgagctggtg
gctgctgagtgtgtgtactgtggggagctgatgattcggtctatcgaccggcccttcatt
gatccgcagcgctatgaggaggagcacctcagctggctatag

DBGET integrated database retrieval system