KEGG   Mus musculus (house mouse): 228662
Entry
228662            CDS       T01002                                 
Symbol
Btbd3, mKIAA0952
Name
(RefSeq) BTB (POZ) domain containing 3
  KO
K10478  BTB/POZ domain-containing protein 3/6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    228662 (Btbd3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     228662 (Btbd3)
SSDB
Motif
Pfam: PHR BTB BACK
Other DBs
NCBI-GeneID: 228662
NCBI-ProteinID: NP_663509
MGI: 2385155
Ensembl: ENSMUSG00000062098
UniProt: P58545 Q8CHC1
Position
2:138098478..138129344
AA seq 530 aa
MVDDKEKNMKCLTFFLMLPETVKNRSKKGSKKANSSGGGGGGGSVGSGSSKLPPVCYEII
TLKTKKKKKMAADIFPRKKPANSSSTTVQQQHQHNLCNNNLIPAPNWQGLYPTIRERNAV
MFNNDLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVFHAMFYGELAEDKDEIRIPDVEPA
AFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQS
CLFEEPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNAKEIVVFEAALNW
AEVECQRQDLALSIENKRKVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFLWY
TASKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGL
YGSSCGSAEYSAKIELKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVV
LDGNELSYFGQEGMTEVQCGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggtagatgataaagaaaagaacatgaaatgtctcaccttcttcttgatgcttccagag
acagtaaagaacaggtccaaaaaaggttcaaagaaagccaacagcagcggtggcggcggc
ggcggcggcagcgttggcagtgggagcagcaagttgcccccagtttgttatgaaataatt
accttgaagactaaaaagaagaagaagatggctgctgatatattcccccgtaagaagcca
gccaactccagcagcaccactgtccagcagcaacaccagcacaacctctgtaacaacaac
ctcatcccggcccccaactggcagggtctttatcccaccatccgagaaagaaatgcggtg
atgttcaataatgacttgatggcagacgtacattttgtggttgggccaccaggtgggact
cagcggttgccaggacacaaatacgtcctcgctgtcgggagctcagtgttccatgcaatg
ttttacggagaactcgctgaggacaaagatgaaatccgaatcccagacgtcgaacctgct
gccttcctcgccatgctgaaatacatctattgtgatgaaattgacttggctgcagacaca
gtgctggccacactgtatgctgccaaaaagtacatagttcctcacctcgccagagcctgt
gttaatttcctggagaccagcctaagcgccaagaacgcctgcgtactcctctcccagagc
tgcctgtttgaggagccggacctgacacagcgttgctgggaggtgattgatgcccaggcc
gagttagcgctcaagtctgagggattctgtgacatcgacttccagacactcgaaagtatc
ctccgcagggaaactctgaatgccaaagaaatagtggtttttgaggcagccctgaactgg
gctgaggtagaatgccagcggcaagatctggccctgagcattgaaaataaacgcaaggtc
ctaggaaaggccctgtacttgatccgcatccctaccatggccctggatgactttgcaaat
ggtgctgcacagtctggggtattgactctcaatgagaccaatgacatcttcctctggtac
actgcatccaaaaaaccagagctgcagtttgtgagtaaagcccgcaagggcctggtcccc
cagcgttgccaccgatttcagtcatgtgcctatcggagcaaccagtggcgctatcggggt
cgctgtgacagcatccagtttgctgttgataagagggtgttcatcgcaggctttgggctg
tacggctccagctgtggctctgccgagtacagcgcaaagatcgaactcaaacggcagggc
gttgtcctgggccagaacttgagcaagtacttctcagacggatccagcaataccttccct
gtgtggtttgagtatccagtgcagattgagccggacaccttctacacagccagtgtagtg
ctggacggcaatgaactcagctactttgggcaggaaggcatgacggaagttcagtgtggc
aaggtgactgtccagttccagtgctcctcagacagcaccaatggcactggtgtacaggga
gggcagatccccgaactcatattctacgcctga

DBGET integrated database retrieval system