KEGG   Mus musculus (mouse): 228715Help
Entry
228715            CDS       T01002                                 

Gene name
Smim26, Gm561
Definition
(RefSeq) small integral membrane protein 26
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 228715
NCBI-ProteinID: NP_001028469
MGI: 2685407
Ensembl: ENSMUSG00000074754
Vega: OTTMUSG00000003920
UniProt: Q3V460
Position
2; 2 G1
AA seq 107 aa AA seqDB search
MRAEKASLWYRRMSLVYALGAWSLLGSAFFLSRKQKVSDCEEGQEDGSRNETPFSTSEDS
DLETETVELGGGFYVKSFLKYSENSVPATQRFLTYLKSWTGGPGPQA
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgaaaaggcctctctctggtaccggcgaatgtcccttgtctacgcacttggc
gcctggtccctgctgggctcggcgtttttcctttcacggaaacagaaagtatcagactgt
gaagaaggtcaagaggatggctcaaggaatgaaacacctttttctacaagtgaagactct
gatttagaaacggaaacggtcgagcttggtggagggttttatgtgaaatcatttttaaag
tattcagaaaattctgtcccagccactcaaaggttcctgacctatctgaagtcatggact
ggtgggcctggcccgcaagcgtga

DBGET integrated database retrieval system