KEGG   Mus musculus (mouse): 228775
Entry
228775            CDS       T01002                                 

Gene name
Trib3, Ifl, Ifld2, N, Nipk, SINK, SK, SKIP3, TRB-3, Trb, Trb3
Definition
(RefSeq) tribbles pseudokinase 3
  KO
K19518  tribbles homolog 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    228775 (Trib3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    228775 (Trib3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  Trbl family
   228775 (Trib3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 228775
NCBI-ProteinID: NP_780302
MGI: 1345675
Ensembl: ENSMUSG00000032715
Vega: OTTMUSG00000015851
UniProt: Q8K4K2
Position
2 G3; 2 74.83 cM
AA seq 354 aa
MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPPSPPPASDLSP
AVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEAQAVLAPYARLPTHQHV
ARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLFRQMASAVAHCHKHGLVL
RDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGK
AADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEP
SERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcgagctacacctctggctgcttctgctgatgtttcctgcaggaagaaaccgttggag
tttgatgacaatattgatgccaagtgtccagtcctaaaacgagtgagagatgagcctgag
cccggaccactccccagcctgctgccccccagcccacctcccgcctcagacttgtcacct
gctgtggcccctgcaactcgactggggccttatatccttttggaacgagagcaaggcagc
tgcagctatcgagccctgcactgccccacaggcacagagtacacctgcaaggtgtaccct
gccagcgaggcccaggcggtgctggcaccttatgcccggctgcctacccaccagcatgtg
gcccgtcccacagaggtcctgctgggctctcggctcctttacatctttttcacgaagacc
catggggacttgcacagcctggtgcgcagccgccgcggtatcccagagtccgaggctgcc
gggctcttccggcagatggctagtgccgtggcacactgccacaagcacgggcttgtcttg
cgcgacctcaagctgcgtcgctttgtcttcagcaactgtgagaggacgaagctggtgctg
gagaacctggaagatgcctgcgtgatgactggatcagatgactctctgtgggacaagcat
gcgtgccctgcctacgtgggaccagagatactcagctcccggccatcctactctggcaaa
gcggctgatgtctggagcctgggtgtggcgctcttcaccatgctggctggcagataccca
ttccacgactctgagccagtcctgctctttggcaagatccgtagagggacctttgccctg
cctgagggcctatcagccccagcccgctgtctgatccgctgtctcctccgcaaggaacct
tcagagcgacttgtggccctgggaatcctcttgcatccctggttgagagaggatcacggc
cgagtctctcctccacagtctgaccgaagggagatggaccaggtggtcccagatgggcca
cagctggaggaggctgaggaaggggaggtggggctgtacggctag

DBGET integrated database retrieval system