KEGG   Mus musculus (mouse): 228801
Entry
228801            CDS       T01002                                 

Gene name
Bpifb1, LPl, Lplunc1
Definition
(RefSeq) BPI fold containing family B, member 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: LBP_BPI_CETP LBP_BPI_CETP_C HAP HHH_6 LRRNT_2
Other DBs
NCBI-GeneID: 228801
NCBI-ProteinID: NP_001012392
MGI: 2137431
Ensembl: ENSMUSG00000027485
Vega: OTTMUSG00000015883
UniProt: Q61114
Position
2; 2 H1
AA seq 474 aa
MAGPWIITLLCGLLGATLVQANVYPPAVLNLGPEVIQKHLTQALKDHDATAILQELPLLR
AMQDKSGSIPILDSFVHTVLRYIIWMKVTSANILQLDVQPSTYDQELVVRIPLDMVAGLN
TPLIKTIVEFQMSTEVQALIRVERSKSGPAHLNLSDCSSNESTLRLSLLHKLSFVVNSLA
KNVMNLLVPALPQIVKNHLCPVIQQAFDDMYEDFLRLTTAPIALSPGALEFGLLSPAIQD
SNILLNLKAKLLDSQARVTNWFNNSATSLMETTPDRAPFSLTVRQDLVNAIVTTLVPKEE
LVILLRFVIPDVARQLQMDIKEINAEAANKLGPTQMLKIFTHSTPHIVLNEGSARAAQSV
VLEVFPTNTDVRPFFSLGIEASYEAQFFTEDNRLMLNFNNVSIERIKLMISDIKLFDPEV
LKDTLTKILEYTLLPNENGKLRTGVPMSMSKALGYEKAMWSVSKGALKLTPASS
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccggcccgtggattatcaccctcctctgtggtttgctgggagccacactggtccaa
gctaacgtctatccccctgcagtgctcaaccttggcccagaagtcatccagaaacacctg
acccaggcactgaaggaccatgatgccactgccatcctccaggagttgccactgctcaga
gccatgcaagataagtctggcagtatccccatactggacagcttcgtgcacaccgttctg
agatacatcatatggatgaaggtcacctctgctaacatcctccagctggatgtgcagcct
tcaacttatgaccaggagctggtggtcagaatccccctggacatggtggctggactaaac
acaccactgatcaagaccatagtggagttccaaatgagcaccgaggtccaagccctcatc
cgggtggagaggagcaagagcggccccgcccacctgaatctcagcgactgctccagcaat
gagagcaccctgcgcctcagcctgcttcacaagctctccttcgtggtcaactccttggca
aagaatgttatgaatctcctggtgccagccctgccccaaatagtgaaaaaccacctgtgc
cctgtgatccagcaggcctttgatgacatgtacgaagacttcctgagactgacaacagca
cccattgccctcagtcctggagccctggagtttggccttctgtctcctgctatccaggac
agtaatatcctgttgaacctgaaggccaagctgctggactcacaggcgagggtaaccaac
tggttcaacaactctgcgacttctctgatggagaccaccccagacagggcccccttcagc
ctgaccgtgaggcaggacctggtgaatgccattgtgaccaccctggtccccaaggaggag
cttgtaatcctgctcagattcgtgattcctgatgtggcccgccagttacagatggacatc
aaggaaatcaatgcagaggcagccaacaagctggggcccacccagatgttgaagatcttc
acccacagcaccccccacattgtgctgaacgagggcagtgccagggcagcccaaagtgtc
gtgctggaagtgttccctaccaacactgatgtccggcccttcttctctctcggcattgag
gccagttatgaagctcagttcttcacagaagacaaccggcttatgctcaacttcaataac
gtcagtattgagcgcatcaagctgatgatctcagatatcaaactattcgatcctgaagtc
ctgaaggacaccctgaccaagatccttgaatacacactgctgcccaatgagaatggcaaa
ctgagaactggagtccccatgtcaatgtccaaggccttgggatacgagaaagccatgtgg
tctgtgagcaagggtgccctcaagctcactccagcctcctcctag

DBGET integrated database retrieval system