KEGG   Mus musculus (mouse): 228807
Entry
228807            CDS       T01002                                 

Symbol
Zfp341, Znf341
Name
(RefSeq) zinc finger protein 341
  KO
K24852  zinc finger protein 341
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    228807 (Zfp341)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    228807 (Zfp341)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz GAGA BolA zf-C2H2_2 zf-H2C2_5 zf-met
Other DBs
NCBI-GeneID: 228807
NCBI-ProteinID: NP_955008
MGI: 2682937
Ensembl: ENSMUSG00000059842
Vega: OTTMUSG00000015920
UniProt: Q6PGC9
Position
2; 2 H1
AA seq 846 aa
MAQAIFEALEGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCKK
QFNSLPAFMTHKREQCQANAPALATVSLATNSIYTPSAAPAAVQQAPPPANRQISTYITV
PPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPPGPPPVQNSLNMHPVPNYLTQPPP
PPPPPPPLPPPPQPPPPPPQTLGPSGRSNPVGNSVVEVYNAAAPMAGNGTVEIQALGMQP
YPPLEVPSQCVEAPVYPTPPVYSPGKQEFKPKGPSSTAPMTNATGSTVATFDSPPTLKTR
RAKGASGLPEAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQK
SNVKKHMQTHKVWPPGRSGGTVSRNSVTVQVMALNPNRQEEEDTGLGQSLSSTTQPQALP
TAGEDEGDKPEAKQVVLIDSSYLCQFCPSKFSTYFQLKSHMIQHKKEQVYKCVVKSCAQM
FPKLDTFLEHIRSHQEELSYRCHLCSKDFPSLYDLGVHQYSHSLLPQHSPKKDSTVYKCV
KCVNKYSTPEALEHHVQTATHSFPCPHCQKVFPCERYLRRHLPTHGSGGRFRCQICKKFF
RKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKE
FNRQDKLKAHILSHAGLKLHKCGLCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFSRH
KYLKDHRCRLGPTKDKDLQARRPPRRRATARGGGSIASGHKEENPMPDPLGLEELKAAGP
SPEAAPGKPPFEQDAVLSIVVGGDPELVVPGHTEGLGSNLALAELQAGTEGGCAMLAVPV
YIQASE
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggcgcaggcgatcttcgaggccctggagggaatggacaatcaaacggttctggccgtc
cagtccttactggatggccaaggagcagtccctgaccccacaggacaaagtgtaaatgcg
ccacctgccatccagccactggatgacgaggatgtctttctctgcgggaagtgtaaaaag
cagttcaactcactgccagccttcatgacccacaagcgtgaacagtgccaggcaaacgcc
cctgccctggccacagtctcgctggctaccaacagcatctatacaccgtcagcagcaccc
gctgccgtccagcaggccccacctcctgccaaccgccagatctccacgtacatcacagtg
cccccctccccactgatccagaccctggtgcaagggaacatcttggtgagcgatgatgtg
cttatgtctgccatgtctgccttcacatccctggaccagccaatgcctccagggccccca
cctgtgcagaacagcttgaacatgcatcctgtgcccaattacctcacccagcctccaccc
cctcctccaccccctccgcctctccccccacccccccagcctcctcctcccccaccccag
actctgggcccttctgggcgctccaaccctgttgggaacagtgtggtggaggtgtacaat
gctgctgctcccatggctgggaacggaacggtggagatccaggcgctggggatgcagccg
tacccgcccctggaggtaccaagccagtgtgtggaggctccagtgtaccccactccccca
gtgtacagccctggcaagcaggaattcaaacccaaaggacccagttccactgcccccatg
accaatgcaactgggagcacggtggccacctttgactccccaccaacgttgaagaccaga
cgtgctaaaggtgccagtggactcccagaagctgcagggaagccaaaagctcagaaactc
aagtgctcctactgtgacaagtccttcaccaagaactttgatcttcagcagcatatccga
agccacacaggggagaagcccttccagtgcattgcgtgtggccgtgcctttgcccagaag
tctaacgtcaagaagcacatgcagactcataaggtgtggcctccagggcgaagtggcggc
acagtctcccgaaactctgtgaccgtacaagtcatggctttgaaccccaacaggcaggaa
gaagaagacacggggttgggtcagtcactgtccagtaccacacagccccaggccttgccc
acggcaggtgaggatgaaggtgacaagccagaggccaagcaggtggtcctgatcgacagc
tcttacctgtgtcagttctgccccagcaagttcagcacctacttccagctcaagtcccac
atgattcagcacaagaaggagcaggtgtacaagtgcgtggtcaaaagctgtgcccagatg
ttccccaagctggacacctttctggagcacatcagaagccaccaggaggagctgagctat
cgctgccatctctgtagcaaggacttcccctcactgtatgacctgggcgtacaccagtac
tcccacagcctcctgccgcagcacagccccaagaaggacagcaccgtctacaagtgtgtc
aagtgtgtcaacaaatactccactcccgaggccttggagcaccacgtgcagacggccact
catagcttcccctgcccgcactgccagaaggtcttcccctgtgaacgctacctgcggcgt
cacttacccacccatggcagtggtggccgattcaggtgccagatctgtaagaagttcttc
cggaaggagcactacctcaagctacacgcccacatccactcaggtgagaagccctacaaa
tgctcagtgtgtgagtctgccttcaaccgcaaagacaagctgaagagacacatgctgatc
cacgagcccttcaagaaatacaaatgccccttctcgatgcacacgggctgcagcaaggag
ttcaaccggcaggacaagctgaaagcccatatcctctcccacgctggcctgaagctccac
aagtgtgggctgtgcagcaagtccttcagccgtcgagctcacctggcagagcaccaacga
gcccacacaggcaactacaagttccgctgcgcgggctgcgccaagggcttctcacgacac
aaatacctcaaggatcaccgctgccgcctgggccccaccaaggacaaggacctgcaagcc
cggcggcctccccggaggagggcaacggcgcgtggtggtggcagcatcgccagcgggcac
aaggaggagaaccccatgccagacccgctggggctggaggagctgaaggccgcaggaccc
tcgcctgaggctgcccctggcaagccaccctttgagcaggacgctgtgttgtccattgtg
gtgggcggggacccggagctggtggtgcctgggcacacagagggtctgggctccaacctg
gcacttgccgagctgcaggctggaaccgagggagggtgtgccatgctcgccgtcccagtc
tatatccaagcctcagagtaa

DBGET integrated database retrieval system