KEGG   Mus musculus (mouse): 228859
Entry
228859            CDS       T01002                                 

Symbol
Fitm2, AI414861, D930001I22Rik, Fit2
Name
(RefSeq) fat storage-inducing transmembrane protein 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Scs3p PAP2 ARL6IP6
Other DBs
NCBI-GeneID: 228859
NCBI-ProteinID: NP_775573
MGI: 2444508
Ensembl: ENSMUSG00000048486
Vega: OTTMUSG00000001072
UniProt: P59266
Position
2; 2 H3
AA seq 262 aa
MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYF
VKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGS
CYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDR
GHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLK
SFSPGLPPQSCSLTLKRDTYKK
NT seq 789 nt   +upstreamnt  +downstreamnt
atggagcacctggagcgctgcgcgtggtttctccgcgggacgctggtgagggcgacggtg
cggcgccacctgccctgggcgctggtggccgccatgctggcgggctcggtcgtcaaggag
ctgtccccgctgcccgagagctacctcagcaacaagcgcaacgtcctcaacgtgtatttt
gttaaattggcctgggcctggacagtctgtctcctcctgcctttcattgcccttaccaac
taccacctgacgggcaagaccagcctggtcctgcggcggttgagcaccctcctcgtgggc
acagccatctggtatatctgcacagccctcttctccaacattgagcactatacaggcagc
tgctaccagtccccggccctggagggcatcagacaggagcatcgcagcaagcagcagtgc
caccgggaagggggcttctggcatggctttgacatctcgggccactccttcctcttgacc
ttctgtgcgctcatgattgtggaagagatggccgtgctgcatgaggtgaagacggaccgc
ggccaccacctccatgccgccatcaccaccctggttgtcgccctgggtttcctgaccttc
atctgggtgtggatgtttctgtgcacagccgtttatttccacgacttgacccagaaagtg
ttcggcaccatgtttggtttgttgggctggtacggaacatatgggtattggtatctgaag
tctttctctccaggacttcctccccagagttgtagtttgactttgaagcgagatacttac
aagaaatga

DBGET integrated database retrieval system