KEGG   Mus musculus (house mouse): 228869
Entry
228869            CDS       T01002                                 
Symbol
Ncoa5, CIA
Name
(RefSeq) nuclear receptor coactivator 5
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: HGTP_anticodon
Other DBs
NCBI-GeneID: 228869
NCBI-ProteinID: NP_659141
MGI: 2385165
Ensembl: ENSMUSG00000039804
UniProt: Q91W39
Position
2:complement(164842273..164876794)
AA seq 579 aa
MNTAPSRPSPTRRDPYSFGDSRDTRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDRRDSRDIRDHRDSRSVREARDLRDFRDFRDLRDSRDFRDHRDPVYDRYRDIRDSRDPL
YRREGSYDRYLRVDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL
YRRYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKND
CREKEREEIARQAAKMANDAILQERDRGGPEEGGRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLLRSSADSLPGPISRQPLGAASGSSLKSQPSSQPLQSGQVLPSATPT
PAAPPTSQQELQAKILSLFNSGAVAANSSSASPSVATGSSQNQNFSTAANSQPQQRPQAS
GNQPPNIVGQAGSARNMGPRPGAPSQGLFGQPSSRLAPASTMASQRPVSSTGINFDNPSV
QKALDTLIQSGPALSHLVSQTAAQVGRPQAPMGSYQRHY
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaatacggctccatcaagacccagccccacacgaagggatccctatagctttggagat
agtcgcgatacaaggcgtgatcgctctccaattcgaggaagtccaaggagagaacccagg
gatggcagaaatggccgggatgcccgtgatagcagagacattcgagatcctcgggatttg
cgggaccgcagagacagcagggacattcgggatcacagagacagcagaagtgtacgtgaa
gcccgggacctgagggattttcgggactttcgtgatctaagagactctagagattttcga
gatcatcgagaccctgtgtatgacagatacagagatataagagattccagagaccctttg
tacaggagagaaggctcatatgaccgttatctgagggtggatgactattgccggaggaag
gatgactcgtactttgaccggtacagagatagctttgatggacggggccctcctggccca
gagagtcaatctcgagcaaaagagcgtttgaaacgtgaggaacgacgtagagaggagctt
tatcgtcggtattttgaggagatccagcgacgctttgatgctgagaggcctgtggattgc
tcagttattgtggtcaacaaacagactaaagactatgctgagtctgtggggaggaaggtg
cgagacctgggcatggtcgtggacctgatcttcctcaacacagaggtgtccctctcacaa
gcgctggaggatgtcagcagaggaggctctcccttcgccattgtcatcacccagcagcac
cagattcaccgttcctgcacagtcaacatcatgttcggaacaccacaagagcatcgcaac
atgccccaggcagatgccatggtgctggtggccagaaattacgagcgctacaagaatgac
tgtcgagaaaaggaacgtgaggagattgcccgacaggcagccaaaatggctaatgacgcc
atcctccaggaaagagatcgtgggggccctgaagagggaggtcgtggagggcaccctcca
gctatccagagcctcatcaacctcctggcagataacagatacctcactgccgaggagacg
gacaagatcatcaactacctgcgcgagcggaaggagcggctcctgaggagcagcgccgac
tctctgcctggcccgatttcccgccagccactcggggcggcctcgggttcctcgctgaag
tcacaaccaagttcacaaccgcttcagagcggccaagtgctcccttctgctacacccact
ccagccgcaccccccacctcccagcaagagcttcaggccaaaatcctcagcctcttcaat
agtggcgcggttgcggccaacagcagctctgcatccccctcagtggctaccggaagctcc
cagaaccagaatttttccacagcagcaaacagccagcctcagcaaagaccgcaggcctca
ggaaatcagcctccaaacattgtgggacaggcagggtctgctcggaacatgggccctagg
cctggggctccttcccaagggctctttggtcagccttccagtcgcctggcacccgccagc
accatggctagccagaggcctgtatcttccacaggtattaactttgacaatccaagtgta
caaaaggctctggacaccctgattcagagtggccctgccctttcccacctggttagccaa
actgcagcacaggtggggcggccccaggcccccatgggatcttaccagaggcattactga

DBGET integrated database retrieval system