KEGG   Mus musculus (mouse): 228889Help
Entry
228889            CDS       T01002                                 

Gene name
Ddx27, C86129
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
  KO
K13181  ATP-dependent RNA helicase DDX27 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    228889 (Ddx27)
   03009 Ribosome biogenesis [BR:mmu03009]
    228889 (Ddx27)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     228889 (Ddx27)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    228889 (Ddx27)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    228889 (Ddx27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_22 UTP25 PRK
Motif
Other DBs
NCBI-GeneID: 228889
NCBI-ProteinID: NP_694705
MGI: 2385884
Ensembl: ENSMUSG00000017999
Vega: OTTMUSG00000001151
UniProt: Q921N6
Position
2; 2 H3
AA seq 760 aa AA seqDB search
MLAELGFIRTIGENDEVPVEPESDSGDEEEEGPIVLGRKQKALQKNRSADFNPDFVFTEK
EGMYDGSWALADVMSQLKKKRAATTLDEKIEKVRKRRKAEDKEAKSGKVEEKEGQADSDL
KGQENPGEDEAGSKDEDSETDYSSEDEEILTKADTLKVKEKKKKKKGQAAGGFFEDASEY
DKSLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFAL
PVLERLIYKPRQAAVTRVLVLVPTRELGIQVHSVTKQLAQFCSITTCLAVGGLDVKSQEA
ALRAAPDILIATPGRLIDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSH
HRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIV
AALLMRTFTDHVMLFTQTKKQAHRMHILLGLLGLQVGELHGNLSQTQRLEALRRFKDEQI
DILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGRAGRSVSLVGEEERKM
LKEIVKAAKAPVKARILPQDVILKFRDKIEKLEKDVYAVLQLEAEEKEMQQSEAQIDTAQ
RLLAKGKETADQEPERSWFQTKEERKKEKIAKALQEFDLALRGKKKRKKFMKDAKKKGEM
TAEERSQFEILKAQMFAERLAKRNRRTKRARAMPEDEPTGPAKKQKQQQKSVFDEELTNT
SKKALKQYRAGPSFEERKQSGLPRQRRGNFKSKSRYKRKK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggagctcggcttcatccggaccatcggcgagaatgacgaggtgccggttgag
cccgagtcggactccggagacgaggaggaggagggacccattgtgctgggccgcaagcag
aaagccttgcagaagaaccgcagtgctgacttcaaccctgactttgttttcactgagaag
gagggcatgtatgatggcagctgggccctggctgatgtcatgagccagctcaagaagaag
cgggcagccactacactagatgagaagattgagaaagtccggaagagaaggaaggcagag
gacaaggaagccaagtctgggaaggtggaggagaaagaaggccaggcagactctgacctg
aaggggcaggagaatccgggtgaggatgaggcaggctccaaggatgaagactctgagact
gactactcctctgaggatgaggaaatcctcaccaaagcagacacactcaaagtgaaggag
aagaagaagaagaagaagggccaggcagcaggaggattctttgaagatgcatccgagtat
gacaaaagcctgtccttccaggacatgaacctctcccggcccctcctgaaggccattaca
gccatgggcttcaagcagcccacgccaatccagaaggcgtgtatccctgtgggtctgctg
gggaaggacatctgcgcctgtgcagccactgggacaggcaaaactgcagcctttgcactg
cccgtcttggagcgtctgatctacaagccccgccaggctgcagtcactcgcgtgctggtg
ctggtccccacgagagagctgggcatccaagtgcactctgtcaccaagcagctggcccag
ttctgcagcatcactacctgcctggctgtgggtggcctggatgtgaagtctcaggaagcc
gctcttcgggcagcaccagacatcctcattgccacacctggccggctcatcgaccacctc
cataactgcccctccttccacctgagcagcattgaagtgctcatcttggatgaggctgac
aggatgctggatgagtatttcgaggagcagatgaaggagattatccgaatgtgttcccac
caccgccagaccatgctcttctcggccaccatgacagatgaggtgaaagatctggcttcg
gtctccttaaagaatcctgtgcggatatttgtgaacagcaacacagatgtcgctcccttc
ctgcggcaagagttcatacggatccggcctaatagggaaggggaccgggaggccattgtg
gcagctctgctgatgagaaccttcactgaccacgtgatgctcttcacccagaccaagaag
caggcccatcgcatgcacatcctcctggggctgctggggctgcaggtgggcgagctccac
ggcaacttgtcacagacccagcgcctggaggccctccggcgctttaaggacgaacagatt
gacatcctggtggccacagatgtggcagcccgcggtcttgacattgaaggagtgaaaaca
gtgatcaacttcaccatgcccaacactgttaaacactatgtgcaccgggtggggcggacg
gcccgtgctggcagggctggacgctctgtctccctagtgggagaggaggagcggaagatg
ctgaaggagatcgtgaaggctgccaaggcgccagtgaaggctcggatccttccccaggat
gttatcctcaagttccgggacaagattgagaaattggagaaagatgtgtatgcagtgctg
cagctggaggcggaggaaaaagagatgcagcagtcggaagcccagattgacacagcacag
cgactcttagccaaagggaaagagacagcagaccaggagcctgagaggagctggttccag
accaaagaagagaggaagaaggagaagattgctaaggctctacaggagtttgacttggcc
ttaagaggaaagaagaaaaggaagaagtttatgaaggatgccaagaaaaagggggagatg
acggcagaggagaggtcccagtttgaaatcctcaaggcacagatgtttgcagagcggctg
gccaagaggaatcgcagaaccaagcgagcacgggcaatgcctgaggacgagcctacaggc
cctgctaaaaagcagaagcagcagcagaagtctgtgtttgatgaagaactcaccaacaca
agcaagaaggccctgaaacagtatcgggctggcccttcctttgaagagaggaaacagtca
ggtctgccccgccagaggagagggaacttcaaatctaagtccaggtacaagagaaagaag
tag

DBGET integrated database retrieval system