KEGG   Mus musculus (mouse): 228980
Entry
228980            CDS       T01002                                 

Symbol
Taf4, 135kDa, AI450312, TAFII130, TAFII135, Taf2c1, Taf4a
Name
(RefSeq) TATA-box binding protein associated factor 4
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    228980 (Taf4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    228980 (Taf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    228980 (Taf4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    228980 (Taf4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     228980 (Taf4)
   Coactivators
    SAGA/TFTC/STAGA complex
     228980 (Taf4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     228980 (Taf4)
SSDB
Motif
Pfam: TAF4 TAFH tRNA-synt_1c
Other DBs
NCBI-GeneID: 228980
NCBI-ProteinID: NP_001074561
MGI: 2152346
Ensembl: ENSMUSG00000039117
Vega: OTTMUSG00000016232
UniProt: E9QAP7
Position
2; 2 H4
AA seq 1042 aa
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPELRAAAAGALGN
HVVSGSPAGAAGAGPAASAEGAPAAAPEPPPAGRARPAGGGPRRPGSSSPRRLLVPAGPA
PAPAKLRPLPEASAGPCPAAAAAAAATAAAVAGPDPAAAAPPAGPGASKPGPPGPPGPGA
AQTLNGSAAPPTAPHAAPAVSPVNNGPAPPPAAGSVIQAAPAPAAPSPPAAPAPAAPPPP
APPAPVAPARPPGHPAAPAPPVSPAAAAAAAAAAAAAQNGAAPAPAAASGGAAGLGQPGA
GAQGAKAEAPKPGPGPGPGPAAAAAAAGVAGGGAAGSVLLGPAMPGALPGPAPGTPAGLA
KGAAAATPSLPRTPAATTGAIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSEN
GQLLMIPQQALAQMQAHAQAQPQSTMAPRPATPTGAPPVQISTVQAPGTPIIARQVTPTT
IIKQVSQAQTTVQPTTTLQRSPGVQPQLVLGGSAQPASLGTATAVQTGTPQRTVPGASTT
STAATETMENVKKCKSFLSTLIKLASSGKQSTETAANVKDLVQNLLDGKIEAEDFTSRLY
RELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPPASQATTALTAVVLSSSVQ
RTAGKTAASVTSALQPPVISLTQPTQVGVGKQAPPTPLVIQQPPKPGALIRPPQVTLTQT
PMVALRQPHNRIMLTTPQQIQLNQLQPVPVVKPTVLPGTKALSTVSAQAAAAQKNKLKEP
GGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDDTFLLPAPLQRRIL
EIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQ
LKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRD
ANLTALAAIGPRKKRKVDCTGPGSGAEGSGPGAAVPGGSGVGTPRQFTRQRITRVNLRDL
IFCLENERETSHSLLLYKAFLK
NT seq 3129 nt   +upstreamnt  +downstreamnt
atggcggcgggctcggatctgctggacgaggtcttcttcaacagcgaggtggacgagaaa
gtggtgagcgatctggtgggctcgctcgagtcgcagctggcggccagcgcggcccaccac
caccacctcgcgccgcgcacgcccgagctgcgggccgcggccgccggcgcgctcgggaac
catgttgtgagcggcagcccggccggagccgcgggcgcagggccggccgcctccgccgag
ggcgcgcccgcagcggcgccggagccgccccccgcaggtagagcgcggccggcgggtggg
ggcccgcggcgcccgggctccagctcaccgcgccgcttgcttgtccccgcagggcccgcg
ccggcgcccgccaagctgaggccgctgcccgaggccagcgcggggccctgccccgccgcc
gctgccgctgccgccgccaccgccgccgccgtcgcggggccggatcccgccgccgccgcc
ccacccgccggccccggcgcctccaagcccggcccgcctggcccgcccggccccggcgcc
gcgcaaactttgaatgggagcgccgcgccgcccaccgcgccgcacgccgcacctgctgtc
agcccggtcaacaacgggcccgcgccgccgcccgccgccggctctgtcatccaggcggcc
cccgcgcccgccgcgccctcgccgcccgccgcgcccgcgcccgccgcgcccccgccgccc
gcgcccccagcgcctgtcgcgccagcccggccgcccgggcaccccgccgcgcccgcgccc
cccgtgtcacccgctgccgctgccgccgccgccgccgctgccgccgccgcgcagaacggg
gccgctcctgcccccgccgcggcctccgggggcgccgcggggttgggccagccgggcgcg
ggcgcgcagggggccaaggccgaggcgcccaagcccggaccggggcccgggccggggccg
gcggcggcggcggcggcggcgggggtcgcgggcgggggcgcggcgggcagtgtgctgctc
gggcccgccatgccgggcgcgctgccggggcctgcgcccgggacccccgcggggctggcg
aagggtgcggccgcggcgacccccagcctgcctcggacgccggcggccaccaccggcgct
atccgggccacgctgacgcccaccgtgctggccccgcgcctgccgcagccgccgcagaac
ccgaccaacatccagaacttccagctgcccccaggaatggtcctcgtgcggagtgagaat
gggcagttgttaatgatccctcagcaggccctggcccagatgcaggcccatgcccaggcc
cagcctcagagtaccatggcaccccgtcctgcaacccccacaggtgctccacctgtccag
atctccactgtgcaggctccaggaacacctattattgcacggcaggtgaccccaactacc
ataattaagcaagtgtctcaggcccagacgacggtacagcccactacaaccctacagcga
tctcccggggtacagcctcagctggttctgggtggctccgcacagccagcctcacttgga
acagccacagctgttcagacagggacacctcaacgaacagtccctggggccagcaccacc
tctacagctgccacggaaactatggaaaatgtgaaaaaatgcaaaagttttctatctaca
ttaataaaactggcttcctctggtaaacagtctacagagacagcggctaatgtgaaagac
ttagtacaaaacttactggatgggaaaattgaagcagaagatttcactagcaggttatac
cgagaactgaactcttcacctcagccttaccttgtgcctttcctgaagaggagcttacct
gccttgagacagctgaccccagactccgcggcctttatccagcagagccagcagcagcag
ccgcctgcttcgcaggccacgactgcactgacggctgtggtgctgagcagctcagtgcag
cgtacagctgggaagacagctgcctcggtgaccagcgccctccagcccccggtcatcagc
ctcacgcagcccacacaggttggcgttggcaagcaggcgccgcccacaccactggtgatc
cagcagcccccgaagcctggagccttgatccggcccccgcaggtgaccttgacgcagaca
cccatggtcgcattgcggcagcctcacaaccggatcatgctcaccacaccacagcagatc
caactgaaccagctgcagccagtccctgtggtgaaacccaccgtgttacctggaaccaaa
gccctgtctactgtatctgcacaagcagctgctgcccagaaaaacaaactcaaggagccg
gggggaggctccttccgggatgatgatgacatcaatgatgttgcgtcaatggctggagtg
aacctgtctgaagaaagtgcaaggatattggccacaaactctgagttggtggggacgttg
acccgatcctgtaaagacgacaccttcctcctccccgcgcctttgcagaggaggatactg
gagataggtaaaaagcacggcatcacggaactgcatccagatgtagtgagttacgtgtct
catgccacacagcaaaggctgcagaatcttgtagaaaaaatatctgaaacggctcagcag
aaaaacttctcttataaggacgacgacagatacgagcaagcgagtgatgtccgggctcag
ctcaaattctttgaacaactggatcagattgaaaagcagaggaaagatgagcaggagagg
gagatcttaatgcgggcagcgaagtctcgatccagacaagaagacccagagcaattaagg
ttgaagcagaaagcaaaagagatgcagcagcaggagctggcacagatgcgacaacgagat
gccaacctcactgcactggcagcgatcgggcccaggaaaaagaggaaagtggactgcact
gggccaggatcaggagcagagggctcaggcccgggcgcagcagtcccaggcggctccggc
gtgggaacccccagacagttcacacggcaaagaatcacgcgggtcaacctcagggacctc
atattttgtttagaaaacgagcgtgagacaagccattcactgttgctctacaaagcattc
cttaagtaa

DBGET integrated database retrieval system