KEGG   Mus musculus (mouse): 228983
Entry
228983            CDS       T01002                                 

Symbol
Osbpl2, C130070J12Rik, OR, ORP-2, Orp2
Name
(RefSeq) oxysterol binding protein-like 2
  KO
K20174  oxysterol-binding protein-related protein 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    228983 (Osbpl2)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    228983 (Osbpl2)
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    228983 (Osbpl2)
SSDB
Motif
Pfam: Oxysterol_BP
Other DBs
NCBI-GeneID: 228983
NCBI-ProteinID: NP_653083
MGI: 2442832
Ensembl: ENSMUSG00000039050
Vega: OTTMUSG00000016257
UniProt: Q8BX94
Position
2; 2 H4
AA seq 484 aa
MNGEEEFFDAVTGFDSDNSSIGEFSEANKISGMIDLDTSKSTRSGKNGEKPQQENGIQKH
RTALPAPMFTRSDFSVWSILKKCIGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHKA
SSQSQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHP
PISAFYSEGLNQDFRFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVH
NVILGQLWIEQYGIVEIVNHRTGDKCILHFKPCGLFGKELHRVEGYIQDKNRKKLFIMYG
KWTECLWGIDPASYESFKKQEKRGDQARKAKMDDGPEKANSDVPGDVADDVPVAQETVQV
IPGSKLLWRINSRPPNSAQMYNFTSFTVSLNELESGMEKTLPPTDCRLRPDIRGMENGNM
DLASQEKERLEEKQREARKERAKEDAEWRTRWFSPGNNPYTGAPDWLYAGHYFERNFSDC
PDIY
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaacggggaggaagaattctttgatgccgtcacaggctttgattctgataattcttct
ataggggaattttcagaggcaaataaaattagtgggatgattgacttggataccagcaaa
agtactaggagtgggaaaaatggggagaaaccacaacaagagaatggaattcaaaagcac
aggacagcccttcctgctcccatgttcaccagaagcgacttcagtgtgtggagtatcctg
aagaaatgcattggcttggaactctccaagatcacaatgccaattgccttcaatgagcca
ctgagcttcctgcagcggatcacagagtacatggagcatgtgtacctcattcacaaagcc
tcaagtcagtcccagccgctggagagaatgcagtctgtcgctgcctttgcggtctcagct
gtggcttcccagtgggagagaactggcaaaccctttaacccactcttgggagagacatat
gagttgatcagggaagacttagggttcagatttatatctgagcaggtcagtcaccaccct
cctattagcgcattttattcagaaggtctcaatcaagacttcaggttccacggttccatc
tacccaaagctgaagttctggggcaagagtgtggaggcggagccccgggggaccatcaca
ctggagctgctcaaacataatgaagcctatacctggaccaaccctacctgctgtgtacac
aatgtcatccttgggcagctatggatagagcagtatgggatagtggagattgtaaatcac
agaactggagataagtgtatacttcacttcaagccttgtggattgtttgggaaggaactt
cacagagtagaagggtacattcaagacaaaaacaggaagaagctctttatcatgtatggc
aagtggacagagtgcttgtggggaatagatcctgcttcatacgagtcctttaagaagcaa
gagaagagaggtgaccaggccaggaaggccaagatggatgatggccccgagaaagctaac
agtgatgtgcctggtgatgtggcagacgacgttcctgtggctcaggagacggtgcaagtc
atccccggcagcaagctgctctggaggatcaacagccggccccccaactctgctcagatg
tacaactttaccagcttcactgtgagtctcaatgagttggagtcaggcatggagaagact
ctgccacccacagactgccgcctccgtcctgacatacgaggcatggagaacggaaacatg
gatctggccagccaggagaaggagcggctagaggaaaagcagagagaggccagaaaagag
cgtgccaaagaggacgcagagtggcggaccaggtggttctctccaggcaataacccctac
acaggagctcctgactggctgtacgccggccattactttgagcgtaacttctcagactgc
ccagacatatactaa

DBGET integrated database retrieval system