KEGG   Mus musculus (mouse): 229004
Entry
229004            CDS       T01002                                 

Gene name
Gmeb2, AI839884
Definition
(RefSeq) glucocorticoid modulatory element binding protein 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SAND DUF5707
Other DBs
NCBI-GeneID: 229004
NCBI-ProteinID: NP_937812
MGI: 2652836
Ensembl: ENSMUSG00000038705
Vega: OTTMUSG00000016562
UniProt: P58929
Position
2; 2 H4
AA seq 530 aa
MATPDVSVHMEEVVVVTTPDTAVDGSGVEEVKTVLVTTNLAPHGGDLTEDNMETENAAAA
AAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSPTSTEYIPLTPAAADVNGSPATITIETCEDPGDWTTTIGDDTFAFWRGL
KDAGLLDEVIQEFQQELEETMKGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVPLPSPMKRPR
LARATSGPAAMASQVLTQSAQIALSPGMPVSQLTSVPLGKVVSTLPSTVLGKGSPQAAPA
SSPASPLLGGYTVLASSGSTFPNAVEIHPDTSSLTVLSTAAMQDGSTVLKVVSPLQLLTL
PGLGPTLQNVAQASPAGSTIVTMPTATATGPEEHTATIEVAAVAEDHEQK
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcaaccccagatgtgagcgtccacatggaggaggtggtggttgtgacaactccagac
actgcagttgatggcagtggtgtagaggaagtgaagacagtgcttgtaacaacgaaccta
gctcctcatgggggtgatttgacagaagataacatggaaacagaaaatgcagcagctgca
gctgctgctgcttttacagcctcctcacagctcaaggaagccgtgttagtgaagatggct
gaagagggggagaacttagaggctgaaattgtgtaccccatcacttgcggagacagcaga
gctaacctcatttggaggaagtttgtgtgccctggcatcaatgtgaaatgtgttcagtat
gatgaacatgtgatcagcccaaaggagtttgtgcacctggcagggaaatctaccttgaag
gattggaagagagccatccggatgaatggcatcatgctcaggaagatcatggactctgga
gagctagacttctaccagcatgacaaggtctgctctaatacttgccgcagcacgaagatt
gacctttcaggggcacgtgtatccctgagcagtcctacatccacagaatacatcccactc
acaccagctgcagctgatgtgaatggctcacctgccaccatcaccatagagacctgtgag
gaccctggtgactggaccacaaccattggagatgacacatttgcattctggcggggatta
aaggatgcgggcttactggatgaagtcatacaggaatttcaacaggagctagaggaaacc
atgaaaggcctgcagcagcgagtgcaggacccacccctgcagctccgagatgctgtcctc
ctcaacaacatcgtgcaaaactttggcatgctggatctggtgaagaaggtactggccagc
cacaagtgtcagatggatcgttcccgggaacagtatgcacgggacctggcagccctggag
cagcagtgtgatgaacatcgccgccgtgccaaggagctgaagcacaagtcccagcacctc
agcaatgtgctcatgacgctgaccccggttccattgccatcccctatgaagcggccccgt
ctcgcccgggctacatctggaccagctgctatggcttcccaggtgctcacacagtctgca
cagattgctttgagtccaggaatgcctgtgtcccagttgaccagtgtgccactgggcaaa
gtagtatctacactgccctccactgtcctgggcaagggctctcctcaagctgccccagcc
agttcaccggcctccccactgctcggaggctacacagttctggcctcctctggctctacc
ttccccaacgcagtcgagatccatccggacacttccagcctcacagttttgagcacagcc
gccatgcaggatggcagcacagtactgaaggtagtcagccccttgcagctgctcaccctg
cctggcctgggacccaccctacagaatgtggctcaggcatcacctgcaggcagcaccatt
gtgacaatgcctacagcaactgccactggacctgaggagcacacggccactattgaggtg
gctgctgtagcagaggaccatgagcagaagtag

DBGET integrated database retrieval system