KEGG   Mus musculus (mouse): 229007
Entry
229007            CDS       T01002                                 

Gene name
Zgpat, 1500006I01Rik, BC021513
Definition
(RefSeq) zinc finger, CCCH-type with G patch domain
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: G-patch zf-CCCH_4 zf_CCCH_4 zf-CCCH_2 zf-CCCH Agenet Bacillus_HBL
Other DBs
NCBI-GeneID: 229007
NCBI-ProteinID: NP_001041613
MGI: 2449939
Ensembl: ENSMUSG00000027582
Vega: OTTMUSG00000016650
UniProt: Q8VDM1
Position
2; 2 H4
AA seq 511 aa
MDEDNLETALQTYRAQLQQVELALGAGLDASEQADLRQLQGDLKELIELTEASLLSVRKS
KLLSTVDQESPAQEDAEYLAFQKAIAEEVEAPGAPCNDSETAPGSEVQPGSTSSALEEEE
EDPDLEELSGAKVNAPYYSAWGTLEYHNAMVVGAEEAEDGSACVRVLYLYPTHKSLKPCP
FFLEGKCRFKENCRFSHGQVVSVDELRPFQDPDLSLLQTGSACLAKHQDGLWHPARITDV
DNGYYTVKFDSLLLKEAVVEGDSILPPLRTEATESSDSDTGDASDSSYARVVEPSTVDTG
TCSSAFAGWEVHTRGIGSKLLVKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCAEI
LQKKTKRGQAGSNRPPKCRRSGSRPEGRPPPRNVFDFLNEKLQSQVPGTPDAGVDTPERR
NKDMYHASKSAKQALSLQLFQTEEKIERTQRDIRGIQEALTRNTGRHNMTTAHLQEKLEG
AQRQLGQLRAQEADLQRKQRKADTHRKMTEF
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggacgaggacaacctagagactgccctgcagacctaccgggcccagctgcagcaggta
gagctggcgctcggtgctggcctagacgcttctgagcaggcggacctgcgtcagctgcag
ggcgatctaaaggagctgattgagctcaccgaggccagcctgttgtcggtcagaaagagc
aagctgctgtctacagtggaccaggagagcccagctcaagaggatgctgagtacctggct
ttccagaaggccattgcggaggaagtggaagcgcccggcgccccctgcaatgactcggag
acggcccctgggagcgaggtgcagccgggatccacctcctctgcactggaggaggaggag
gaggacccagatctggaggaactgagcggtgctaaagtgaatgccccctactacagcgct
tggggcacgctggagtatcacaacgctatggtagtgggcgccgaagaggcggaggatggt
tctgcgtgcgtccgagtcctctacctataccctacccacaagtccctgaagccctgtccg
ttcttcctggagggaaagtgccggttcaaggagaactgcaggttctcccatgggcaggtg
gtatctgtggatgagctgcgtccctttcaggatccagacttaagcttactgcagactggc
tctgcatgtctggccaagcaccaggatggcctgtggcacccagcacggatcactgatgtg
gacaatggctactataccgttaagtttgactcattgctgctgaaggaggctgtagtggag
ggggacagcatcctgcctcctctgcgcactgaggctacagagtcatctgactcagacact
ggtgatgcaagtgactccagctatgccagagtggtggaaccaagcacggtggacactggg
acctgcagttctgcctttgctggctgggaggtacacacacggggcattggctccaaactc
ctcgtcaagatgggctatgagtttggcaagggtttgggccggcatgcagaaggccgggtg
gagcccatccatgctgtagtgttgcctagagggaaatcactggaccagtgtgcagagata
ctgcagaagaagacaaagcgaggccaggctgggtccaacaggcctccaaaatgccggagg
agtggtagtagacctgagggccgcccacccccccggaatgtgtttgactttttgaatgaa
aaactgcaaagccaggttcctgggaccccagatgctggggtggataccccagagagaagg
aacaaagacatgtatcacgccagcaagagcgccaagcaggctttgagcctgcagctcttc
cagactgaggagaagattgagcggacccaacgggacatccggggcatccaggaggcccta
acccggaacactggccggcacaatatgacgacagcccatctgcaggagaagctggaggga
gcccagcggcagctgggtcagctgcgtgctcaggaggctgacctacagaggaaacagcgg
aaggcagacactcacaggaagatgacagagttctag

DBGET integrated database retrieval system