KEGG   Mus musculus (mouse): 229096
Entry
229096            CDS       T01002                                 

Symbol
Ythdf3, 9130022A11Rik
Name
(RefSeq) YTH N6-methyladenosine RNA binding protein 3
  KO
K20102  YTH domain-containing family protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    229096 (Ythdf3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     229096 (Ythdf3)
SSDB
Motif
Pfam: YTH
Other DBs
NCBI-GeneID: 229096
NCBI-ProteinID: NP_001139391
MGI: 1918850
Ensembl: ENSMUSG00000047213
Vega: OTTMUSG00000051093
UniProt: Q8BYK6
Position
3; 3 A1
AA seq 585 aa
MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQNNSYPPMSDPYMPSY
YAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLG
QHGFNFFPGNADFSTWGTSGSQGQSTQNSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSK
VPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNNVPPVSSAAPKPTSWAA
IARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTI
IQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQSQQPQLQNRWVAPRNR
GTGFNQNNGTGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMK
SVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPL
EKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgtcagccactagcgtggatcagagacctaaagggcaaggaaataaagtttcagtacaa
aatggttcgattcatcaaaaagatgctgtaaatgatgatgattttgagccatacttaagt
agccagacaaatcagaataacagctatccaccaatgtcagatccatatatgcctagttac
tatgctccgtccattggatttccatattctcttggggaagcagcatggtccacggctgga
gatcagcctatgccatatctgacaacctatggacaaatgagtaatggagaacatcattat
ataccagatggtgtttttagtcaaccaggggcattaggaaatacccctccatttcttggt
caacatggatttaacttttttcctggtaatgctgatttctctacatggggaacaagtgga
tctcagggacaatcaacacaaaattctgcttatagtagcagttacggctatccacctagt
tctcttgggagagctattactgatggacaggccggatttggcaatgatactttgagtaag
gtgcctggcattagtagtattgagcaaggcatgactggactgaaaattggtggtgacctg
acagctgcggtgacgaaaactgtaggtacagccttgagcagcagtggtatgactagcatt
gcaaccaataatgtgccccctgttagcagtgcagcacctaaaccaacttcttgggctgct
attgccagaaagcctgcaaaacctcagccgaaacttaaacccaagggcaatgtgggaatt
gggggttctgctgtgccaccacctcctataaaacacaacatgaatattggaacttgggat
gaaaaggggtcagtggtaaaggctccaccaacccaaccagttctgcctcctcaaactata
atccagcagcctcagccattaattcaaccaccaccattggtgcaaagccaactgcctcaa
cagcagcctcagccaccacaaccacagcagcaacaaggacctcagccacaggcccagcct
caccaagtgcagtctcaacagccacagttgcagaatcgttgggtagctcctcggaatagg
ggaaccggcttcaaccagaacaatggaacaggcagtgaaaactttggtttaggtgttgtg
cctgttagtgcttcaccttctagtgtagaggtgcatccagtgctggaaaaactaaaggcc
ataaacaattataatcccaaagactttgattggaacctgaagaatggacgtgtgtttata
attaagagctattctgaggatgatatacatcgttccatcaagtactctatctggtgtagt
actgagcatggtaataagcgtttggatgcagcttatcgttccctgaatgggaaaggccca
ctctatttactcttcagtgtgaatggcagtggacatttttgtggagtggctgaaatgaag
tctgttgtagactataatgcttatgctggtgtctggtctcaggataagtggaagggcaaa
tttgaagttaaatggatctttgtcaaagatgttcccaataaccaattacgacatattcgc
ttagaaaataatgacaacaaaccagtaaccaattcaagggacactcaagaagtaccccta
gaaaaagcaaagcaagtgcttaaaataatcgctactttcaagcataccacctcaatcttt
gatgactttgcacattatgaaaagcgtcaagaggaggaggaagccatgcgaagggagaga
aatagaaacaagcaataa

DBGET integrated database retrieval system