KEGG   Mus musculus (mouse): 229228
Entry
229228            CDS       T01002                                 

Symbol
Nudt6, Asfgf2b
Name
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 6
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Nudix_hydro NUDIX NUDIX_4
Other DBs
NCBI-GeneID: 229228
NCBI-ProteinID: NP_705789
MGI: 2387618
Ensembl: ENSMUSG00000050174
Vega: OTTMUSG00000007435
UniProt: Q8CH40 A0A0R4J176
Position
3; 3 B
AA seq 312 aa
MWWVRRTRYWFSTLLYAGGARLRPGRRTASGGLETPGSCGAELQGELDRFGGVSVHLSRH
HTLHGLDAAAFRRLLQAAIQQWRSEGRIAAWLHIPILQSHFIAPAASLGFCFHHAKPHSS
TLTLWLGEGPSRLPGYATHQVGVAGAVFDVSTRKVLVVQDRNKLKNMWKFPGGLSEPGED
IDTAVREVFEETGVKSEFRSLLSIRQQHRSPGAFGMSDMYLVCRLQPRSFTINFCQQECL
KCEWIDLENLARTKHTTPITSRVARLLLYGLREGFDKIDLSMEELPAVYTGLFYKLYHRE
LPESYKAATGAD
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtggtgggtgaggaggacccgctactggttctccacattgctttacgcgggcggagcc
aggctccggccggggcggcgcacagcctcgggcggcctggagaccccgggctcctgcggg
gccgagctacaaggcgagctggacagatttgggggcgtctcggtgcacttgtcgcggcac
catacgttgcacgggctggatgccgccgccttccggaggctcttgcaggctgccattcag
cagtggcgctcagaaggacggatagctgcctggctacacatccccatcctgcagagccac
ttcattgcccctgctgcttccctgggcttttgcttccaccacgcaaaaccccattcctca
acactgactctgtggctgggagaaggacccagcagactcccgggatatgctacacaccaa
gttggagttgcaggtgctgtatttgatgttagcaccaggaaagtactggttgtacaagat
cgaaataaattgaaaaacatgtggaagtttccaggaggcctgtcggagccaggagaagat
attgacacagcagtccgagaggtttttgaagagactggtgtcaagtcagaattcaggtcc
ctgttgagcatccggcagcaacacaggagccctggggccttcgggatgtcagacatgtac
ctggtctgccgcctgcagcctcgttccttcactatcaacttctgccagcaggaatgcttg
aagtgtgaatggattgatctagaaaacctggcccggactaaacacacgacccccatcacc
agcagggtggctaggctactgctgtatggactcagggaagggtttgacaaaattgacctc
agcatggaggagctccctgcagtgtacacaggcctgttctacaaactctatcacagggag
ctgccggagagttacaaagccgcaacgggagcagactga

DBGET integrated database retrieval system