KEGG   Mus musculus (mouse): 229323
Entry
229323            CDS       T01002                                 

Gene name
Gpr171, A630006E05, F730001G15Rik, H963
Definition
(RefSeq) G protein-coupled receptor 171
  KO
K08441  G protein-coupled receptor 171
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    229323 (Gpr171)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   BigLEN
    229323 (Gpr171)
SSDB
Motif
Pfam: 7tm_1 DUF4044
Other DBs
NCBI-GeneID: 229323
NCBI-ProteinID: NP_775574
MGI: 2442043
Ensembl: ENSMUSG00000050075
Vega: OTTMUSG00000052446
UniProt: Q8BG55
Position
3; 3 D
AA seq 319 aa
MTNSSTFCPVYRDLEPFTYFFYLVFLIGIIGSCFATWAFIQKTTNHRCVSIYLINLLTAD
FLLTLALPVKIIVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLIHSC
KIYRIQEPGFAKMISAVVWLMVLLIMVPNMVIPIKDIKEKSNVGCMEFKKEFGRNWHLLT
NFICVAIFLNFSVIILISNFLAIRQLYRNRDNTNYPSVKSALLHILLVTASYIICFVPYH
AVRIPYTLSQTEVISDCSTRIALFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVTETF
ASPKKSKPLEERLRSENDV
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacaaacagttcaacgttctgtccggtttacagagatctggaaccatttacctatttt
ttttatttagttttcctcattggaattattggaagttgttttgccacgtgggcttttata
cagaaaaccacaaatcacagatgtgtcagcatatacttaattaatttgcttacagctgat
ttcctgctcaccctggcattaccagtaaaaatcattgttgacttgggtgtggcaccctgg
aagctaaggatattccactgccaagtgacagcctgcctcatctacatcaatatgtactta
tctattatcttcttagcctttgtcagcatcgatcgctgtcttcagttaatacacagctgc
aagatataccgaatacaagaacctgggtttgccaaaatgatatcagctgtcgtgtggctc
atggtcctgctgatcatggtgccgaacatggtgattcccatcaaggacatcaaagaaaag
tcaaatgtaggttgcatggagtttaaaaaggagtttggaagaaactggcatttgctaaca
aacttcatctgtgtggcaatatttttaaatttctcagtcatcattttgatatccaacttc
cttgcaatcagacaactctatagaaatagagacaacacaaactatccaagtgtgaaatca
gctctgctccacattctcttggtgacagctagttacatcatatgctttgttccctaccac
gctgtcaggatcccatacaccctcagccagacagaggtcatatctgattgctcaactagg
atcgcactcttcaaagccaaagaggccacactgctgctggcggtgtctaatttgtgtttt
gatccaatcctgtactatcatctgtcaaaagcctttcgactaaaggtcaccgagactttc
gcctcacctaaaaagagcaagcctctggaagaaagattgagaagtgagaatgatgtgtaa

DBGET integrated database retrieval system