KEGG   Mus musculus (mouse): 229363Help
Entry
229363            CDS       T01002                                 

Gene name
Gmps, 670032, AA591640, AI047208, Gm9479
Definition
(RefSeq) guanine monophosphate synthetase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
Module
mmu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    229363 (Gmps)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    229363 (Gmps)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    229363 (Gmps)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     229363 (Gmps)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   229363 (Gmps)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATase GMP_synt_C Peptidase_C26 NAD_synthase QueC tRNA_Me_trans ATP_bind_3 Asn_synthase PAPS_reduct ThiI Arginosuc_synth rve Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 229363
NCBI-ProteinID: NP_001028472
MGI: 2448526
Ensembl: ENSMUSG00000027823
Vega: OTTMUSG00000031018
UniProt: Q3THK7 B2RRH9
Position
3; 3 E1
AA seq 693 aa AA seqDB search
MALCNGDSKPENAGGDLKDGSHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETP
AFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPILGICYGMQMMNKVFGGTVHK
KSVREDGVFNISMDNTCSLFRGLQKEEIVLLTHGDSVDKVADGFKVVARSGNIVAGIANE
SKKLYGVQFHPEVGLTENGKVILKNFLYDIAGCSGNFTVQNRELECIREIKEKVGTSKVL
VLLSGGVDSTVCTALLNRALNQDQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
HSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMSLKPE
EVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR
ILGRELDLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPH
TLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDW
ESLIFLARLIPRMCHNINRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILR
ESGFAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGVPATPGNEIPVE
VVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtgcaacggagattccaagccggagaatgctggaggagatcttaaggatggt
tctcaccattacgaaggagctgttgtcattctggatgctggagcccagtatgggaaagtc
attgaccgaagagtgcgggagctctttgtgcagtctgaaatcttcccattggaaacacca
gccttcgccataaaggaacaaggatttcgggctattatcatatctggaggacctaattct
gtgtatgcagaggatgctccctggtttgatccagcaatatttaccattggcaagcctatt
ctaggaatttgctatggcatgcagatgatgaataaagtctttggaggcactgtgcataaa
aaaagtgttagagaggatggagttttcaacattagtatggataatacgtgttcattattc
aggggcctgcagaaggaagaaattgttttacttacacatggagacagtgtagacaaagtt
gctgatggattcaaggttgtagcacgttctgggaacattgtggcaggtatagccaatgaa
tctaaaaagctatacggtgtacagttccaccctgaagttgggcttacagaaaatgggaag
gtaatactgaagaatttcctgtatgatatagctggatgcagtgggaactttactgtgcag
aaccgagaacttgaatgcattcgagagattaaagagaaagtaggaacatcaaaagtgttg
gttttactcagtggtggtgtagattcaactgtttgtacagctttgctaaatcgtgctttg
aaccaagatcaagtcattgctgtacacattgataatggctttatgagaaaacgagaaagc
caatctgttgaagaggccctcaaaaagcttggaattcaagtcaaagtgataaatgctgct
cattccttctacaatggaacaactactctaccaatctcagatgaagacaggaccccacgg
aaaagaattagcaaaacattaaatatgacaacaagtcctgaggagaaaagaaaaattatt
ggtgatactttcgttaagattgccaatgaagtaattggagaaatgagtctgaagcccgag
gaggtttttctcgcccaaggcactttacggcctgatctaatcgaaagtgcgtcccttgtt
gccagtggtaaagccgaactcatcaaaacccaccacaacgacacagaacttatcaggaag
ttaagggaagagggaaaagtaatagaacctctgaaagattttcataaagatgaagtcagg
attttaggcagagagcttgacctgccagaagaattggtttccaggcatccttttccaggt
cctggcctggcaatcagagtaatatgtgctgaagaaccttatatttgtaaagacttccct
gaaaccaacaatattttgaaaatagtagctgatttttctgcaagtgttaagaagcctcat
acactgttacaaagagtcaaagcctgcacaacagaagaggaccaggagaagctcatgcaa
attacaagtctgcattcactcaatgctttcttgctgccaattaagactgtaggtgtacag
ggtgactgtcgttcttacagttatgtgtgtggaatctcaagtaaagatgaacctgactgg
gaatctcttattttccttgccagacttatacctcgaatgtgtcataacattaacagagtt
gtctatatctttggtccaccagttaaagagcctcctacagatgttactccaacttttttg
acaacaggagtgctcagtactttacgccaagctgattttgaggcccataacattctcagg
gagtctgggtttgctgggaaaatcagccagatgccagtgattttgacccctttacatttc
gatagagatccacttcagaagcagccttcatgccagaggtctgtggttattcgaaccttt
attactagtgacttcatgactggtgtacctgcaacacctggcaatgagattcctgtagag
gtggtgctaaagatggtcactgagataaagaagattcctggaatttctagaattatgtat
gacctaacttcaaagcccccgggaaccactgagtgggagtaa

DBGET integrated database retrieval system