KEGG   Mus musculus (mouse): 229445Help
Entry
229445            CDS       T01002                                 

Gene name
Ctso, A330105D01Rik, AI118514
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    229445 (Ctso)
  09143 Cell growth and death
   04210 Apoptosis
    229445 (Ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    229445 (Ctso)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     229445 (Ctso)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   229445 (Ctso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 229445
NCBI-ProteinID: NP_808330
MGI: 2139628
Ensembl: ENSMUSG00000028015
Vega: OTTMUSG00000026582
UniProt: Q8BM88 Q4QQL3
Position
3; 3 E3
AA seq 312 aa AA seqDB search
MKPQLVNLLLLCCCCLGRHGVAGTWSWSHQREAAALRESLHRHRYLNSFPHENSTAFYGV
NQFSYLFPEEFKALYLGSKYAWAPRYPAEGQRPIPNVSLPLRFDWRDKHVVNPVRNQEMC
GGCWAFSVVSAIESARAIQGKSLDYLSVQQVIDCSFNNSGCLGGSPLCALRWLNETQLKL
VADSQYPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQEDEMARALLSFGPLVVIVDAMS
WQDYLGGIIQHHCSSGEANHAVLITGFDRTGNTPYWMVRNSWGSSWGVEGYAHVKMGGNV
CGIADSVAAVFV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcagttggtgaacctcttgctactgtgttgctgctgtctcggccgccacggg
gtcgccgggacctggtcttggagccaccagcgggaggccgccgccttgcgggaaagcctt
catagacaccgatacttgaactcttttcctcatgaaaactccactgccttctatggagta
aatcagttttcttatttgtttcctgaagagtttaaagctttgtatttaggcagcaaatat
gcctgggctcccagatacccagcagaaggacagagacctatccccaatgtgtctttgcca
ttgagatttgactggagggacaagcatgttgtgaatcctgtaaggaaccaggagatgtgt
ggaggatgctgggccttcagcgtggtgagtgccatagagtcagctcgtgcaatccaaggg
aaatctctggattacctgagcgtgcagcaggtcatcgactgctcctttaataattctggc
tgcctcggtggctctcctctctgtgccttgcgctggctaaatgagacacagttgaagttg
gtggcagattcacagtacccattcaaggcagtaaatggccagtgtcgccactttcctcaa
tcacaagctggagtttcagtcaaggatttttctgcatataacttcaggggccaagaggat
gaaatggccagagcacttctgtccttcggccctttggttgtgatagttgatgcgatgagc
tggcaggattatctggggggcataatccaacatcactgctccagtggggaggccaaccat
gccgttctcatcacaggctttgataggacaggaaatacaccatattggatggtgcgaaac
tcctggggatcctcctggggagtagaaggctatgcccacgtgaaaatgggaggtaatgtt
tgtggcattgcagactctgtagctgctgtctttgtgtga

DBGET integrated database retrieval system