KEGG   Mus musculus (house mouse): 229473
Entry
229473            CDS       T01002                                 
Symbol
Tmem131l, D930015E06Rik, Kiaa0922, mKIAA0922
Name
(RefSeq) transmembrane 131 like
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TMEM131_like TMEM131_like_N ASH
Other DBs
NCBI-GeneID: 229473
NCBI-ProteinID: NP_766269
MGI: 2443399
Ensembl: ENSMUSG00000033767
UniProt: Q3U3D7
Position
3:complement(83805512..83947497)
AA seq 1597 aa
MAGLRRPQSGAYRRTAAAVNLLLGVFQVLLSCCRPGGAQGQAFEPLPNVVELWQAEEGEL
LLPTQGDSEEDMEEPSQEQSFSDKLFIGKGLHFQPSVLDFGIQFLGHPAAKLLYAYNPSR
ESEVVVNSVFTAARHFHVPPVHCRVIPAMGKASFRVIFLPTEEGSIESSLFINTSSHGVF
SYHVSGVGTRRVSTEGSAEQLPNAYFLLPQVQSIQLSQTQAETTNTSLLRVQLECSLHNK
VCQQLKSCSLGSDDALHLEMNIIVAVENSSKQPEENTQALLDHLSIVYVATDESDTSDES
AVNMYVLHSGNSLIWIQDIHHFSQKNVLSLQFEPVLLSTSTTNFTKIASFTCKAGTSCDS
GIMGLRKKKASPAMQACLSSPVVQGYFRTDASTAQFHIESHETATGVWSIWYRSHFDQSI
VLKDVFVSKETKHILKVLSFRGPLFLPPGCWNIFSLKLAVKGIVLNLFTNVFLTTNTGAI
FAIPLQIFSAPTKEGSLGFEVLAHCGMHYFMGKSKTENPNWERSLSLDRSTWDMDSELAN
KLYERWKKYKSGDACRRNVLGMSQFAFTKKSKETEPFVSFLPRVVPEPNLVLNFSATALR
NSAVKYFVVRNPTPQPVSLQLLPLSLYPRPEAAVRLLHKWFGTDMQMVNLSTGEFQLTQA
CPYQGEPSEESSLGALHVHLQALETRRVGVVFTPADYGKVTSLILIRNNLTVVDMVGVEG
FGAQELLKVGGRLPGAGGSLRFKVPESTLMDCHRQLKDSKQILSITKNFKVENIGPLPIT
VTSLKINGYNCQGYGFEVLDCHPFSLSPNTSRDISIVFTPDFTSSWVIRELTLVTAADLE
FHFTLNVTLPHHMLPLCAEVVPGPSWEESFWRLTVFFVSLSLLGVILIAFQQAQYILMEF
MKTRQRQNGSSSSQQNGDPVAMISSHPHKSTCKNFLDTYSPSDKGRGKSCLPVGPSLSRL
QNAAKRSPATYGHSQKKHKCSFYYSKQKPSASAASSANVTTEEKQTVTLASSLSVAKEDI
CTNVLSENWVSLRYASGINGSLQKNLTLPKNVLHKEESSLKNTVVTNTPSECSMKEGVHT
YMFPKETDSKISENVAELKEQEPCPQKTSKKPPESTLPKTPPQYLQSDLPEVSRKHGNKQ
QAPVRSEVDSFEPVRAADAEPSSVRKTQGASPEDTCSEKQDTPSAEQEDPSRKRKLQERR
EGSTQALNWNKTRPCRRNKKRASAQASSSPRPSEQSEQRLVCSDVRSWCAQDGAGEKCKA
GTEVSGSSPERREEDSYYQKSEKKCADKFCSDSSSDCGSSSGSVRASRGSWGSWSSSSSD
CDRRPVVDIQHFLPPGDGVSPQNFPSEASVPLSLPQHVCSSTDVSVLPEFTESPCPGLPA
TPAGAGEEKGLYPPGGLWPSQPVCLTSSFNCPVENGAPGVSQEPTSIPDSSFIDWSASCE
GQFPSVYCPLELNDYNAFPEENMNYTNGFPCSSKVQTDFIGHSTPSTWNTPASMPAAWGH
ASLVNSPSYLTSTRSLSPMSGLFGSIWAPQSEVYETCCPISPATEHATHMENQVMCKEYY
LGFNPFRAYMNLDIWTSTANRNANFPLSRDSSYCGNM
NT seq 4794 nt   +upstreamnt  +downstreamnt
atggcggggctccggcgcccgcagtccggcgcctaccgccgcacggccgctgccgtgaac
cttctgctgggcgtcttccaggtcctgctgtcctgctgccgtccgggaggggctcaggga
caagcgtttgagcccttgccgaacgtggtggagctgtggcaggcagaagaaggggaactc
ctgctgcccactcagggtgattctgaagaggatatggaggagccttctcaagaacagagc
ttctcagataaactgttcattggaaaaggcttacattttcagccgtcagttctagatttt
ggaatacagttcctgggacatcctgcggcgaagcttctctatgcctacaaccccagcagg
gagagcgaggttgtggtgaactcagtgtttacagctgctagacatttccatgtgccgcct
gtccattgcagggtgattccagcaatgggaaaagcatccttcagagttattttcttacct
accgaagaagggagcatcgaaagctctttatttattaatacctcctcacacggagtcttc
tcctatcatgtatctggagtgggcactcgcagagtctctacagaagggtctgcggagcag
ctgccgaacgcatactttctgcttccacaggtccaaagtattcagctttcacagacacag
gcagagaccactaataccagcctgctgcgggtgcaactggaatgcagtttacataataaa
gtgtgtcagcaattgaagagttgctctctgggatctgatgatgcgctacacttggagatg
aacatcattgtagcagtggaaaactcctccaagcaacctgaagagaacactcaagccctg
ctagatcacctctctattgtctatgtagctactgatgagtctgacacctcagatgaatct
gcagtaaatatgtatgtactgcattcaggaaacagccttatttggatacaggatatacat
catttctcacagaaaaatgtcctgtctctgcagtttgaaccagtactgctctctacttcc
acgacaaacttcacaaaaatcgcctcgtttacttgcaaagcaggtacctcgtgtgacagt
ggaatcatgggcctgaggaaaaaaaaagctagcccagcaatgcaagcctgcctgtcctct
cctgtggtgcaggggtatttcagaacggatgcctctacagcccagtttcacatagagagt
cacgagactgcaacaggagtctggtcaatatggtaccgcagccattttgaccagagcatt
gtattaaaagatgtgtttgtttccaaggagaccaagcacattttaaaggttctgagtttc
cgaggccctttatttctacccccaggctgttggaatatattttctctgaagcttgctgtt
aaaggcattgtcttaaacctgttcaccaatgtatttctgactacaaacacaggtgccatt
tttgcaatacctctgcagattttctcggccccaaccaaggaagggagtctgggttttgaa
gtgctagcacattgtggcatgcattatttcatgggaaagtcaaaaacagaaaatcctaat
tgggaaagaagcctttctctggatcggtccacctgggacatggattctgaacttgcaaat
aagctgtatgaaagatggaagaaatataaaagtggcgatgcttgcagaagaaatgttttg
ggaatgtctcagtttgcatttacaaagaaatccaaggagacagagccgtttgtctccttt
ttgcctcgtgtggtcccggaacccaaccttgtgttgaacttcagtgccaccgccctcagg
aacagtgcggtgaagtactttgtggtgaggaacccgactccccagcctgtctccctgcag
ttgctgcctctctccctatacccgaggcctgaagccgcagtgcgcctgctccacaaatgg
tttggcacagatatgcagatggttaatctctcaactggtgaattccagctcacgcaagct
tgcccttaccagggcgaaccttctgaggagtccagtttgggagctcttcatgtgcacttg
caggctttggaaacgagaagggttggtgttgtgttcacaccagcagactatggcaaagtc
acctccctcatcctgatcaggaataacttgactgtcgttgacatggttggtgtggaagga
tttggagcacaagagctcttgaaagtgggaggaagacttcctggtgcaggaggctctctc
cgatttaaggtgcctgagtccaccctgatggattgtcatcgacaactgaaagatagcaag
cagattttatctattacaaagaacttcaaagttgagaatatcggacctcttcccataact
gtgacatccttgaaaatcaatgggtataactgccagggttatggatttgaagtgctagat
tgccatccgttttcactgagcccaaacacatcccgagacatcagcatcgtgtttactcca
gactttacctcttcctgggtcatccgtgagctgacgctggtcactgcagcagacctagaa
ttccacttcacactcaatgtgaccctccctcaccacatgctgcccttgtgtgcggaggtg
gttccaggtcccagctgggaggagtccttttggaggctcactgtcttctttgtcagtttg
tccctgctgggtgtgattctaatagccttccagcaagcacagtacattttgatggaattc
atgaaaacaagacagaggcaaaacggcagctcctcttcccagcagaacggtgatccagtg
gctatgatcagttcccatcctcacaaaagcacttgcaagaacttcctggacacatacagc
ccatctgacaaaggtagagggaagagctgccttccagtgggcccatccctgagcaggctg
cagaatgccgccaagaggagcccggccacctatggtcattctcagaagaagcataaatgc
tccttctactacagcaaacagaagcccagtgcatctgcggccagcagtgccaacgttacc
actgaggagaagcagactgtgaccctggcaagctccctgtctgtggccaaggaagacatt
tgcactaatgtcctcagtgagaactgggtcagcctcagatatgccagtggcatcaatggc
agcttgcagaagaatctaacccttcccaaaaatgtactgcacaaagaggaaagctcactg
aaaaacacagttgtcactaacactccttcagaatgtagtatgaaggagggagtacacaca
tatatgtttcctaaggaaactgacagcaaaatttcagagaatgtggctgagctcaaggaa
caagagccctgtccacagaagacttctaagaagccacctgaaagtactttgcccaaaacc
ccacctcagtaccttcagtcagacttgccagaagtttccaggaaacatggaaataagcag
caagcgcctgtcaggagtgaagtggacagctttgagcctgtgagagccgctgacgcagag
ccgtcctcagtgaggaagacgcagggggcatctccagaagacacgtgctccgagaagcag
gacacaccttcagcagagcaggaagatccttccaggaagaggaagcttcaggagaggaga
gaaggaagcacacaagccctcaactggaataaaacccgaccttgtaggagaaacaagaaa
agggcctctgcccaggcctccagttctcccaggccttctgagcagagcgaacagaggctt
gtctgcagtgacgtcagaagctggtgtgcacaggacggcgctggggagaaatgtaaggct
ggcacggaagtttcgggcagctcccctgaacggagagaggaggacagttactaccagaag
tctgagaagaagtgtgcagacaagttttgctcggactctagctccgactgtggcagctcc
tccggcagtgtgcgggccagccggggcagctggggcagctggagcagtagcagctctgat
tgtgacaggaggccagtggtggacatacagcacttcctgccacctggagatggtgtttcc
ccacagaatttcccttcagaagcttcggtccccttgagcctcccacagcacgtctgcagc
tctacagatgtgagtgtcctgcctgagttcacagagtccccctgtcctggtcttcctgcc
acacctgcaggtgctggagaagagaaaggtctgtatccacccggaggcctgtggccttcc
cagccagtgtgtctgaccagcagcttcaactgcccagtggagaacggtgccccaggggtg
tctcaggagcccacctccatccctgacagcagtttcattgattggagtgcatcctgcgaa
ggccaatttcccagtgtgtactgccctctggaactgaacgattacaatgccttcccagaa
gaaaacatgaattataccaatggcttcccctgctcctcgaaagttcagacggacttcatt
ggccacagcaccccctctacctggaacactccggccagcatgcccgctgcctggggccat
gccagtctcgtcaactctccatcctacctcacgagcacccgaagcttgtctcccatgtct
ggactctttggttccatctgggccccacaaagtgaagtgtatgaaacctgctgccccatc
agccctgccacagagcatgcaacccacatggaaaaccaggtcatgtgcaaggagtactac
ctgggctttaacccgttccgtgcctacatgaacctggacatatggactagcacagcaaat
cgcaatgcaaacttccccctgtccagagactccagctactgtgggaacatgtga

DBGET integrated database retrieval system