KEGG   Mus musculus (mouse): 229593
Entry
229593            CDS       T01002                                 

Gene name
Golph3l, 2010204I15Rik, AU015439, AW549227, C77637, Gpp34r
Definition
(RefSeq) golgi phosphoprotein 3-like
  KO
K15620  golgi phosphoprotein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    229593 (Golph3l)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Others
    229593 (Golph3l)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    229593 (Golph3l)
 Protein recycling
   Rab11 associated proteins
    229593 (Golph3l)
 Endosome - Golgi transport
   Rab associated proteins
    229593 (Golph3l)
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    229593 (Golph3l)
SSDB
Motif
Pfam: GPP34 DUF3974
Other DBs
NCBI-GeneID: 229593
NCBI-ProteinID: NP_001171140
MGI: 1917129
Ensembl: ENSMUSG00000046519
Vega: OTTMUSG00000042031
UniProt: Q8R088 K3W4N3
Position
3; 3 F2.1
AA seq 280 aa
MCYSLSATKDQEVCTLCVAEKFFTYWNPPRVRETGALQNESANCSLRPTAAQEQRQGYTS
FWNDCISSGLRGGILIELAMRGRIYLEPPTMRKKRLLDRKVLLKSDSPTGDVLLDETLKH
IKATEPTETVQTWIELLTGETWNPFKLQYQLRNVRERIAKNLVEKGILTTEKQNFLLFDM
TTHPVTNTTEKQRLMKKLQDSVLERWVNDPQRMDRRTLALLVLAHSSDVLENVFSCLTDD
KYDVAMNRTKDLVELDPEVEGTKHNATEMIWAVLAAFNKS
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtgttattccctctctgcaacgaaggatcaggaagtttgtactctctgtgtggctgag
aagtttttcacctactggaacccgcctagggtacgggaaacaggtgccctccaaaacgag
agcgcgaactgcagcctacgtcccactgcagctcaggagcaacgtcagggctacacatct
ttctggaatgactgtatatcatctggactgcgaggaggcattctgatagagctggccatg
cggggtcgaatctatctggaacctcccaccatgcgtaagaagcgactcctagacagaaag
gtcctgctgaagtcagacagcccaacaggtgatgttttgctggatgagacgctcaaacac
attaaagcaactgagccaaccgaaactgtgcagacgtggatcgagctactcactggtgag
acatggaaccctttcaaattacagtaccagctgagaaatgtacgagaacgaattgccaag
aacctggtggaaaagggcattctaaccacagagaagcagaatttcctgctcttcgacatg
accactcatccagtgaccaatacgacagagaaacagcgactaatgaaaaagcttcaagac
agtgtgctagaacggtgggtaaatgaccctcagcgcatggacaggcgaacactggccctc
ctggtgctggcccactcttctgatgtgctggagaatgtcttctcttgtctgacagatgat
aagtatgatgtggcaatgaatcgaaccaaggacctagtagaactggaccctgaagtggag
gggacaaagcacaatgctacagagatgatctgggctgtgctggcagccttcaacaaatcc
taa

DBGET integrated database retrieval system