KEGG   Mus musculus (house mouse): 229658
Entry
229658            CDS       T01002                                 
Symbol
Vangl1, Kitenin, Lpp2, Stb2, Stbm
Name
(RefSeq) VANGL planar cell polarity 1
  KO
K04510  vang-like
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    229658 (Vangl1)
SSDB
Motif
Pfam: Strabismus
Other DBs
NCBI-GeneID: 229658
NCBI-ProteinID: NP_808213
MGI: 2159344
Ensembl: ENSMUSG00000027860
UniProt: Q80Z96
Position
3:complement(102060899..102112012)
AA seq 526 aa
MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQAPAGEPLLAND
SARTGAEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASF
LGLLVFLTPIAFILLPQILWREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRAD
VPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAI
VLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTAS
KFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRR
ARLVVAVEEAFIHIQRLQAEEQQKSPGEVMDPREAAQAIFPSMARALQKYLRTTRQQHYH
SMESILQHLAFCITNSMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLISEEAVTNGLRDG
IVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggataccgaatccacgtattctggatattcctactactcaagccattccaaaaaatct
cacaggcaaggggaaagaacaagagaaagacacaaatcaccaaggaataaagatggcaga
gggtcagaaaagtctgtcaccatccaggctcctgctggagagcccctgctggcaaatgac
tctgcccgcacaggcgcagaggaagttcaggatgacaactggggagagaccaccaccgca
atcacaggcacctcagagcacagtatatcccaagaggacattgccaggattagcaaggac
atggaggacagtgtggggctggattgcaagcgctatctgggcctcaccgttgcctcgttc
cttggactacttgtcttcctcacccccattgccttcatcctgctaccccaaatcctgtgg
agggaggagctgaaaccctgtggcgccatttgtgagggacttctcatttctgtatcattc
aaactgcttattctgctcatcggaacctgggcacttttcttccgcaagcaaagagcggat
gtgccgcgggtgtttgtgttccgagcgctgttactggtccttatctttctttttgtggtt
tcttactggcttttttatggggtccgcattttggactctcgggaccaaaattacaaggac
atcgtgcaatacgcagtctctcttgtggacgcgctgcttttcatccactaccttgccatc
gtcctgctggagctgaggcagctgcaacccatgttcaccctgcaggtggtccgctccacc
gacggagagtcccgcttctacagcttgggacacttgagcatccagcgagcagccttggtg
gttctggaaaattactacaaggacttcaccatctataacccgaacctcctaacagcatcc
aaattccgagcagccaagcacatggctggcctgaaagtctacaatgtagatgggcctagt
aataacgccactggtcagtcccgagccatgattgctgcagcagctcggcgcagagactcc
agccacaacgagttgtattatgaagaggccgaacacgaacgcagggtgaagaagcggaga
gcaagactggtagtggctgtggaggaagccttcatccatatccagcgtctccaggctgag
gagcagcagaagtctcccggagaggtgatggaccccagagaggcagcccaggccatcttc
ccctccatggccagggcactgcagaagtacctgcgcaccacacggcagcagcactaccac
agcatggagagtatcctgcagcacctggccttctgcatcaccaacagcatgacccccaag
gctttccttgaacgatacctcagtgcgggccccaccttgcagtatgacaaggatcgatgg
ctctcgacacagtggagacttattagtgaggaggctgtgacaaacgggttacgggatgga
attgttttcgtccttaaatgcttggacttcagcctcgtggtcaatgtgaagaaaatccca
ttcattgtactctcagaagagttcatagaccctaaatctcacaagtttgttcttcgctta
cagtctgagacatcagtctaa

DBGET integrated database retrieval system