KEGG   Mus musculus (mouse): 229700Help
Entry
229700            CDS       T01002                                 

Gene name
Rbm15, C230088J01Rik, mKIAA1438
Definition
(RefSeq) RNA binding motif protein 15
  KO
K13190  RNA-binding protein 15
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    229700 (Rbm15)
   03041 Spliceosome [BR:mmu03041]
    229700 (Rbm15)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     229700 (Rbm15)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    229700 (Rbm15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPOC RRM_1 Nup35_RRM_2 RRM_3
Motif
Other DBs
NCBI-GeneID: 229700
NCBI-ProteinID: NP_001039272
MGI: 2443205
Ensembl: ENSMUSG00000048109
Vega: OTTMUSG00000052948
UniProt: Q0VBL3
Position
3; 3 F2.3
AA seq 962 aa AA seqDB search
MRSAGREPLPRRSPRWRRASPLCETSAGWRVSQLRRDDLRRPSTMKGKERSPVKPKRSRG
GEDSSSRGERSKKLGGSGGSNGSSSGKTDSGGSRRSLHLDKSSSRGGSREYETGGGSSSS
RLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGVEYKTLKISELGSQL
SDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVLY
DRPLKIEAVYVSRRRSRSPLDKDAYAPSSSVVGTSVGSHRHAPGGGGGQRSLSPGGAALG
YRDYRLQQLALGRLPPPPPPPLPRELERERDYPFYDRVRPAYSLEPRVGAGAGAAPFREV
DEISPEDDQRANRTLFLGNLDITVTENDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKF
ENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTI
RTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPL
PLTHYELVTDTFGHRAPDPLRSARDRTPPLLYRDRDRDLYTDSDWVPPPPPVRERSARAA
TSAVTAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESER
PRKQRHCTPSPDRSPELSSNRDRYNSDNDRSSRLLLLERSSPVRDRRGSLEKSQSDKRDR
KNSASAERDRKHRTAAPTEGKNPLKKEDRSDGNAPSASTSSSKQKPPSQKQDGGTAPVAA
SSPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQ
PKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSDTAASTQRPLRNLVSYLKQKQ
AAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRAKLVN
SG
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgcggggcgggagcctttgccgcggcggagtccaagatggcggcgtgcgagt
ccgctgtgtgaaacgagcgcggggtggcgggttagtcagctccgcagagacgacctccgg
cgaccctcaacaatgaaaggaaaggagcgctcgccggtcaagcccaagcgctcccgtggc
ggtgaggactccagttctcgtggggagcggagcaagaagttagggggctccggcggcagc
aatgggagcagcagcgggaagacggacagcggcgggtcgcggcggagccttcatctggac
aagtccagcagccggggcggcagccgcgagtacgagaccggcgggggcagctccagtagc
cgcttgcacagttacagctccccgagcaccaaaaattcctcaggcgggggcgagtcgcgc
agcagctcccggggtggaggcggggagtcacgttcctccggggccgcctcctccgcgccc
ggcggcggggacggcgtggagtacaagaccctgaagatcagcgagctggggtcccagctg
agcgacgaggcggtggaggacgggctgtttcacgagttcaaacgcttcggtgatgtaagt
gtcaaaatcagtcacctctcaggttctggcagcggggatgagcgggtagcctttgtgaac
ttccggaggccagaggacgcgagggcggccaagcatgccagaggccgcctggtgctctat
gaccggcctctgaagatagaagccgtgtacgtgagccggcgccgcagccgctccccgtta
gacaaagatgcttacgccccgtcatccagcgtggtcgggacctcagtcggtagccaccgg
cacgcccctggaggagggggaggtcagaggtcgctttcccctggaggtgctgctctggga
tacagagactaccggttgcagcagttggccctgggccgcctgcctcctccacccccgcca
ccattgccccgagagctggaaagagaacgagactatccgttctatgaccgggtgcgcccg
gcctacagcctggagccgagggtgggagctggagcaggtgcggctcctttccgagaagtg
gatgagatatcacctgaggacgatcagcgtgccaaccggacacttttcttgggcaactta
gatatcactgtgacggaaaatgatctcagaagggcttttgatcgttttggagtcatcaca
gaagtggacattaagaggccttctcgaggccagaccagtacctatggctttctcaaattt
gagaatctagacatgtctcacagggccaaacttgcaatgtctggcaaaattataattcgg
aatccaatcaagattggttatggtaaagccacacccactacccgactttgggtgggtggt
ctgggaccctgggtgcctcttgctgccctggcacgagaatttgaccgatttggcaccatt
cgaaccatagactaccgtaaaggtgacagttgggcatatatacagtatgaaagtttggat
gcagctcatgctgcctggacccatatgcgtggattcccacttggtggcccagatcgtcgc
ctcagggtagactttgcagacacagaacatcgttaccagcagcaatatcttcagcctctg
cccttgacccactatgaactagtgacggatacttttggacatagagcacctgaccctttg
aggagtgctcgggacaggacaccacccttactatacagagatcgtgatagggacctttat
actgattctgactgggtgccacccccaccaccggttcgagaacgcagtgctcgggctgca
actagtgctgtcactgcttatgagccactagatagcttggatcgaaggagggatggctgg
tcactggacagggacagaggtgatcgggacttgcccagcagcagggaccagccaaggaag
cgaaggctgcctgaggaaagtggaggacggcatcttgatagatcacctgagagtgaacgg
cctcgaaaacagcgtcactgcactccttctcctgaccgaagtccagaactgagcagtaac
agagatcgctacaacagtgacaatgatcgatcatctcgtcttctcctcttggaaaggtct
tccccagtcagagatagacggggcagtttggagaagagccagagcgacaagcgagaccgt
aaaaactctgcatcagctgaacgggataggaagcatcggacagctgctcccacagaggga
aaaaaccctctgaaaaaggaagaccgatctgatggcaatgcacccagtgccagcacttct
tcatcaaagcagaagccaccttcccagaaacaggatggagggacagctcctgtggcagca
tcctctcccaaactctgtttggcttggcagggcatgcttctactgaagaacagcaacttc
ccttccaacatgcatctgttgcagggtgacctccaagttgctagcagtctacttgtggag
ggctcaactggaggcaaagtggcccaactcaagatcactcagcggctccgtttggaccaa
cccaagttggatgaagtaactcgacgcatcaaagtggcagggcctaatggttatgccatt
ctcctggctgtacctggaagttctgacagccgatcttcctcttcctcagccacatcagac
actgccgcctctactcagaggccacttaggaaccttgtgtcctatttaaagcaaaagcag
gcagctggggtgatcagcctccctgtgggaggcaataaagacaaggaaaacaccggggtt
cttcatgccttcccaccttgtgagttctctcagcagttcctggattcccctgccaaggca
ctggccaaatctgaagaagattacctggtcatgatcattgtccgtgcaaaactggtgaac
agcggatga

DBGET integrated database retrieval system