KEGG   Mus musculus (mouse): 229714Help
Entry
229714            CDS       T01002                                 

Gene name
Gpr61
Definition
(RefSeq) G protein-coupled receptor 61
  KO
K08414  G protein-coupled receptor 61
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    229714 (Gpr61)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    229714 (Gpr61)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Pex24p
Motif
Other DBs
NCBI-GeneID: 229714
NCBI-ProteinID: NP_001292390
MGI: 2441719
Ensembl: ENSMUSG00000046793
Vega: OTTMUSG00000007190
UniProt: Q8C010
Position
3; 3 F2.3
AA seq 449 aa AA seqDB search
MESSPIPQSSGNSSTLGRALQTPGPSTASGVPELGLRDVASESVALFFMLLLDLTAVAGN
AAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHALFGEVACRLYLF
LSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVGVWVKALAMASVPVLG
RVYWEEGAPSVNPGCSLQWSHSAYCQLFVVVFAVLYFLLPLILIFVVYCSMFRVARVAAM
QHGPLPTWMETPRQRSESLSSRSTMVTSSGAHQTTPHRTFGGGKAAVVLLAVGGQFLLCW
LPYFSFHLYVALSAQPISAGQVENVVTWIGYFCFTSNPFFYGCLNRQIRGELSKQFVCFF
KAAPEEELRLPSREGSIEENFLQFLQGTSENWVSRPLPSPKREPPPVVDFRIPGQIAEET
SEFLEQQLTSDIIMSDSYLRPAPSPRLES
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcacccatcccccagtcatcaggaaactcgtccactttgggaagggccctt
caaaccccaggtccctctactgccagcggggtcccagagttgggattacgggacgtggct
tcagaatctgtggccctcttcttcatgctcctgttggatctcactgctgtggctggcaat
gctgctgtgatggctgttattgccaagacacccgccctccgaaaatttgtttttgtcttc
catctttgtctggtggacctgctggctgccctgaccctcatgccgcttgccatgctctcc
agctctgccctctttgaccacgccctctttggggaggtggcctgccgcctctacctgttc
ctgagcgtttgctttgtcagcctggccatcctttcggtgtctgccattaatgtggagcgc
tactattatgtggtccacccaatgcgctacgaggtgcgcatgacactagggctggtggcc
tccgtgctggtgggcgtgtgggtaaaggccctagccatggcttctgtgccagtgttggga
agggtctactgggaggaaggagctcccagtgttaaccccggctgttctctccaatggagc
catagtgcctactgccagctttttgtggtggtctttgctgttctgtacttcttgctgccc
ttgatcctgatctttgtggtctactgcagcatgtttcgagtggctcgcgtggctgccatg
caacacgggccgctgcccacgtggatggagacgccccggcaacgctctgagtctctcagt
agccgctctactatggttaccagctccggggctcaccagaccaccccacaccggacgttt
gggggtgggaaggcagcagtggtcctcctggctgtagggggacagttcttgctttgttgg
ttgccctacttctctttccatctctatgttgccctgagcgcacagcccatttcagcagga
caggtggagaacgtggtaacctggattggctacttttgcttcacttccaacccctttttc
tacggatgtctcaaccgtcagatccggggcgagcttagcaaacagtttgtctgcttcttc
aaggcagctccagaggaggagctgaggctgcctagtcgtgagggctccattgaggagaat
ttcctgcagttcctccaggggacctctgagaactgggtttctcggcccctacccagtcct
aagcgggagccaccccctgttgttgactttcgaatcccaggccagattgctgaggagacc
tcagagttcctggagcagcaactcaccagcgacatcatcatgtccgacagctacctccgt
cccgccccctcaccaaggctggagtcatga

DBGET integrated database retrieval system