KEGG   Mus musculus (mouse): 229722
Entry
229722            CDS       T01002                                 

Gene name
Elapor1, 5330417C22Rik, BB183350
Definition
(RefSeq) endosome-lysosome associated apoptosis and autophagy regulator 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ephrin_rec_like NCD3G
Other DBs
NCBI-GeneID: 229722
NCBI-ProteinID: NP_001028476
MGI: 1923930
Ensembl: ENSMUSG00000040412
Vega: OTTMUSG00000007254
UniProt: A2AFS3
Position
3; 3 F3
AA seq 911 aa
MKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANLEVDDSISESTENCTSSKWVPR
GDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPSADDSRWMK
TTEKGWEFHSVELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITGVAYTSECFPCKPGT
YAAKQGSPFCKLCPANYYSNKGETSCHPCDADKYSEKGSSTCKVRPACTDKDYFYTHTAC
DAQGETQLMYKWAIPKICGEDLEGAVKLPASGVKTRCPPCNPGFFKTDNSTCEPCPYGSY
SNGSDCTHCPAGTEPAVGFEYKWWNTLPSNMETTVLSGINFEYKGLTGWEVAGDHIYTAV
GASDNDFMILTLVVPGFRPPQSVVADTENKEVARITFVFETICSVNCELYFMVGMNSRTN
TPVETWKGTKGKQSYTYTIEENATVSFTWAFQRTTLHETGRKYTNDVAKIYSINVTNVMG
GVASYCRPCALEASDLGSSCTSCPAGHYINRDSGTCHLCPSNTILKAHQPYGAQACVPCG
PGTKNNKIHSLCYNDCTFSRNTPSRIFNYNFSALAGTVSLAGVPSFTSKGLKYFHHFTLS
LCGNQGKKMAVCTDNVTDLRIPDGEAGFSKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSL
ADRLVGVSTDMTLEGIVSPVELFHPETSGIPDIVFFFRSNDVTQSCSSGRSTTIRLRCNP
MKAAPGTLRLPSMCSDGTCDGCNFHFLWESVAACPLCSASDYHTFVSSCVAGIQKTTYMW
REPKLCSGGISLPEQRVTICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYS
KLVMNATLKDCDLPAADSCAIMEGEDVEDDFIFTSKKSLFGKIKSFTSKRTPDGFDSVPL
KTSSGGPDMDM
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgaaggaccagtcctgcaagccctgcgcggagggccgctactccctcggcactggcatc
cgatttgatgagtgggatgagctacctcacggctttgccagcctctcggccaacttggag
gtcgatgacagcatctcggagtccactgagaactgcacttcgtccaagtgggttccccgg
ggagactacatcgcctccaacacagatgaatgcaccgccacactgatgtatgccgtcaac
ctaaagcagtctggcaccgttaactttgagtactactacccggactccagcatcatcttt
gaattttttgtccagaatgaccagtgccagcccagtgctgatgactccaggtggatgaag
actacggagaaaggatgggaattccacagtgttgagctaaatagaggcaataacgtcctc
tattggagaaccacagctttctcggtgtggtccaaagtgtccaagcccgtgcttgttaga
aacatcgccataacaggggtggcttacacctccgagtgtttcccctgcaagcctggcaca
tacgctgccaagcagggctcccctttctgcaagctttgtccagccaactactactcaaac
aaaggagaaacgtcctgccatccgtgtgatgctgacaaatactcagaaaaaggatcttcc
acctgcaaagtgcgcccagcctgcacagacaaggactatttctacacccacacagcctgt
gatgctcagggagagacacagctcatgtacaaatgggccataccaaaaatctgcggtgag
gacctggagggggcggtgaagctgcccgcctctggtgtgaagacccgctgcccaccctgt
aacccgggcttcttcaaaaccgacaacagcacctgtgaaccttgcccatacggctcgtac
tccaacggctcggattgtacccactgcccagcaggaactgagcctgccgtgggatttgag
tacaaatggtggaacacactgccctccaacatggaaactacggttctcagtgggatcaac
tttgaatacaagggcctgacaggctgggaggtggctggtgaccacatttatacagctgtt
ggtgcctcagacaacgacttcatgattctcactctggttgtaccaggatttagacctcca
cagtcagtggtggcagacacagagaacaaagaggtggccaggatcacatttgtcttcgag
accatctgctctgtgaactgtgagctctacttcatggtgggcatgaattccaggaccaat
actcctgtggagacgtggaagggcaccaaaggcaagcagtcctatacctacaccatcgaa
gagaatgctactgtgagcttcacatgggccttccagaggaccacccttcatgaaacaggc
aggaagtatactaatgatgtcgccaagatctactcaatcaatgtcaccaacgtcatgggg
ggcgtggcctcctactgccgtccctgtgccctagaagcctctgatttgggctcctcctgc
acctcttgtcctgctggccattacatcaaccgggattctgggacctgccacctctgtccc
tctaacaccatcctgaaagctcaccagccttacggtgcacaggcctgtgtgccctgtggt
ccagggaccaagaataacaagatccactctctctgctacaacgactgcaccttctcccga
aacacccccagcaggattttcaactacaacttctcagctctggcaggcaccgtctctctg
gcaggggtgccgagcttcacctcgaaggggctgaagtattttcatcatttcaccctgagt
ctctgtggaaaccaggggaaaaaaatggctgtgtgcacagacaatgtcactgacctccgg
atccctgatggtgaggccggcttctctaagtccgtcacagcctatgtctgccaggttgtc
atcatcccctctgaggtgatgggctacaaggccggggtgtcctcacagcccgtcagcctt
gctgaccgacttgttggagtgtcaacagacatgaccttggaaggaatcgtctccccagtt
gaactttttcacccagagacctcgggaattccggacatagtcttcttttttagatccaat
gatgtgacccagtcctgcagttctggaagatcaaccaccatccgcctcagatgcaatcca
atgaaagctgctcctggcaccctgcggctacccagcatgtgctctgatgggacctgtgat
ggctgtaacttccacttcctgtgggagagtgtggccgcttgtccactctgctcggcctct
gactaccacacttttgtcagcagctgtgtggctgggatccagaagactacttacatgtgg
cgagaaccaaagctgtgctctgggggcatttccctgcctgagcagagagttaccatctgc
aaaacgatcgatttctggttaaaagtgggcatctcggctggcacctgcactgccatcctg
cttactgtcctgacctgctacttttggaagaagaatcaaaaattagaatacaaatactcc
aagttggtaatgaacgctactcttaaagactgcgacctgccggcagcagacagctgtgcc
atcatggaaggagaggacgtggaggatgacttcatctttaccagcaagaagtccctcttt
gggaagatcaaatcctttacctccaagaggactcctgatggatttgactcggtgccgctg
aagacgtcttcaggaggcccagacatggacatgtga

DBGET integrated database retrieval system