KEGG   Mus musculus (mouse): 229731Help
Entry
229731            CDS       T01002                                 

Gene name
Slc25a24, 2610016M12Rik
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    229731 (Slc25a24)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   229731 (Slc25a24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_10 EF-hand_4 DUF2340
Motif
Other DBs
NCBI-GeneID: 229731
NCBI-ProteinID: NP_766273
MGI: 1917160
Ensembl: ENSMUSG00000040322
Vega: OTTMUSG00000007353
UniProt: Q8BMD8
Position
3; 3 F3
AA seq 475 aa AA seqDB search
MLRWLRAFVLPTAACHDAEPPTRYETLFRALDRNGDGVVDIGELQQGLQSLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEPSEIVQSLQMLGL
HISEKQAELILQSIDSDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMMQVHGSKSMNIFGGFRQMV
KEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKLGTFERFISGSMAGATA
QTFIYPMEVLKTRLAVAKTGQYSGIYGCAKKILKHEGFGAFYKGYIPNLLGIIPYAGIDL
AVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQLASYPLALVRTRMQAQATVEGA
PQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVAQK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctggctgcgggcctttgtgctgcccaccgccgcctgccacgacgcggagccg
cccacacgctacgaaacgctcttccgggcgctggaccgcaatggggacggcgtggtggac
atcggagagctgcagcaggggctgcaaagcctgggcatcccgctgggccaggacgcggag
gagaaaattttcaccactggcgatgtcaacaaagatgggaagctggattttgaagaattt
atgaaatacctgaaagaccatgagaagaaaatgaaattagcatttaaaagtttggacaag
aataatgacgggaaaatcgagccttctgaaattgtccagtctctccagatgctcggttta
catatttctgaaaagcaagcagagctgattcttcaaagcatcgactctgatgggacgatg
accgtggactggaatgaatggagggattactttttatttaaccctgtgacagacattgag
gaaattatccgtttctggaaacactctactggaattgacataggggatagtttaactatt
ccagatgaattcacagaagatgagaaaaaatcaggacagtggtggaggcagctcctggca
ggaggtgtggcgggcgccgtctctagaacgagcaccgctcctttggatcgcctcaaggtc
atgatgcaggttcatggttccaaatcaatgaatatatttggaggctttcggcagatggta
aaggaaggaggaatccgttccctttggagaggaaatggcaccaatgtcatcaaaatagct
cccgagacagctgtgaagttctgggcttatgaacagtacaagaagttgcttaccgaggaa
ggacaaaaattagggacctttgagaggtttatctctggttccatggctggagcaactgct
cagacttttatttaccccatggaggttttgaaaacccggctagctgtagccaaaactgga
caatactccggaatatacggttgtgccaagaagattttgaaacacgaaggctttggggct
ttttacaaaggctacattcccaatttactaggcatcattccttacgcaggcattgatctc
gctgtgtacgagcttttgaagtcttattggctggataactttgccaaagactcggtcaac
cctggcgtgatggtgctgctgagctgtggagccctatccagcacctgtgggcagctggcc
agctaccccctggctttggtgagaactcgcatgcaggctcaagccacggtagaaggagcc
ccgcagctgagcatggttggcctttttcagcgaatcgtctccaaagaaggagtgtcagga
ctttacagaggcatcaccccaaacttcatgaaagtgctcccggccgtgggcatcagctat
gtggtgtatgaaaatatgaagcagaccctgggagtagctcagaagtga

DBGET integrated database retrieval system