KEGG   Mus musculus (mouse): 229801
Entry
229801            CDS       T01002                                 

Gene name
Tram1l1, A830091N21Rik
Definition
(RefSeq) translocation associated membrane protein 1-like 1
  KO
K14010  translocating chain-associated membrane protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    229801 (Tram1l1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Other DBs
NCBI-GeneID: 229801
NCBI-ProteinID: NP_666252
MGI: 2443503
Ensembl: ENSMUSG00000044528
Vega: OTTMUSG00000052583
UniProt: Q8QZR0
Position
3; 3 G1
AA seq 363 aa
MGLRKKNARNPPVLSHEFMVQNHADMVSCVGMFFVLGLMFEGTSEMSIAFLTLQHGVVVP
AEGLPSGSRTLYHYGVKDLATVFFYMLVAIIIHATIQEYVLDKLSRRLQLTKGKQNKLNE
AGQLSVFYIVSGIWGMIILASENCLSDPTLLWKSQPHNMMTFQMKFFYISQLAYWFHSFP
ELYFQKVRKQDIPGQLIYIGLHLFHIGGAYLLYLNHLGLLLLMLHYAVELLSSVCSLLYF
GDERYQKGLSLWPIVFISGRLVTLIVSVVTVGLHLAGTNRNGNALSGNVNVLAAKIAVLS
SSCSIQVYITWTLTTVWLQRWLEDANLHVCGRKRRSRARKGTENGVENPNRIDSPPKKKE
KAP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggggctccgcaagaagaacgccaggaaccccccggtgttgagccacgaattcatggtg
cagaaccacgcggatatggtctcctgcgtgggcatgttcttcgtgctggggcttatgttc
gagggcacctccgagatgtcgatcgcgttcctcactctgcagcatggagtcgttgtccca
gcggaagggctgccctccgggtccaggaccctgtaccattatggggtcaaagatctggcc
acagtgttcttctacatgctggtggccatcatcatccacgccaccattcaggagtacgtg
ctagataagctcagcaggagactgcagctcaccaaaggcaaacaaaacaaactgaatgag
gccgggcagctgagtgtgttctatatagtgtccgggatctggggcatgatcattctggcc
tctgagaactgcctgtcagaccctacactcttgtggaagtctcagccccacaacatgatg
acatttcagatgaaatttttctacatttcacagttggcttactggtttcatagctttccg
gagctttacttccagaaagtcaggaagcaagatatcccgggtcagctcatctacattggc
ctccacctcttccacattggaggggcctatctcttgtacttgaaccacttgggcctgctg
ctgctgatgctgcactacgccgtagagctcctctccagcgtgtgcagcctgctttacttt
ggtgatgagcggtaccagaaagggttgtctctgtggcctatcgtgtttatatccgggaga
ctcgtgacattgattgtctcggtggttacagtagggcttcacctggccgggacaaatcgg
aatggcaatgcactctctggtaatgtcaatgtgctggcagctaaaatcgctgttctgtcc
tcgagttgcagtatccaggtgtacataacatggaccttgactactgtctggcttcagaga
tggttagaagacgcgaaccttcatgtttgtggaaggaagagacggtccagggcgagaaaa
ggcacagaaaatggagtggagaatccgaatagaatagactctccaccaaagaagaaagag
aaggctccttaa

KEGG   Mus musculus (mouse): 72265
Entry
72265             CDS       T01002                                 

Gene name
Tram1, 1810049E02Rik, TR, TRAMP
Definition
(RefSeq) translocating chain-associating membrane protein 1
  KO
K14010  translocating chain-associated membrane protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    72265 (Tram1)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1 DUF3671
Other DBs
NCBI-GeneID: 72265
NCBI-ProteinID: NP_082449
MGI: 1919515
Ensembl: ENSMUSG00000025935
Vega: OTTMUSG00000049113
UniProt: Q91V04 Q4FK14
Position
1; 1 A3
AA seq 374 aa
MAIRKKSNKNPPLLSHEFLLQNHADIVSCLAMLFLLGLMFEVTAKGAIIFVALQYNVTRP
ATEEQATESASLYHYGIKDLATVLFYMLVAIIIHAIIQEYVLDKINRRMHFSKTKHSKFN
ESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNLMTFQTKFFYISQLAYWLHAF
PELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHLGLVLLVLHYFVEFLFHISRLFY
FSDEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAENQKLDFSTGNFNVLAVRIAV
LASICITQAFMMWKFINFQLRRWREHSAFQAPPVKRKPAVTKGRSSRKGTENGVNGTVTS
NGADSPRNRKEKSS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgattcgcaagaagagcaacaagaacccgccgctgctgagccacgaattcttgctg
cagaatcacgcggacatcgtctcctgcctggcgatgcttttcctgctggggcttatgttc
gaggtaacagcaaaaggagccatcatctttgttgctcttcagtataatgttacccgccct
gcaacagaagaacaagctactgaatcagcatccctatatcactatggtatcaaagacttg
gctacagttttgttctacatgctagtggcgataattattcatgccataattcaggagtat
gtgttggataaaattaaccgacggatgcacttctccaaaacgaagcacagcaagtttaac
gagtctggtcagctcagtgcattctacctttttgcctgtgtgtggggcacgttcattctc
atctccgaaaactatatctcagacccaactatcctgtggagagcctatccccataacctg
atgacatttcagacgaagtttttctacatctcccagctggcgtactggctccatgcattc
cctgaactctacttccagaaaaccaaaaaagaagatatccctcgtcagctcgtctacatt
ggcctttatctctttcatattgctggagcctatcttctgaacttgaaccacctgggcctt
gtccttctggtgctgcactatttcgttgaatttcttttccacatttctcgtctattttat
tttagtgacgagaagtatcagaaagggttttctctctgggcagttctttttgttttggga
agacttctgactctaattctttcagttcttactgttggttttggtctcgcaagagcggag
aatcagaagctggactttagtactggaaacttcaacgtgttggccgttaggatcgctgtt
ctcgcgtccatttgcatcacacaagccttcatgatgtggaagttcattaacttccagctt
cggaggtggagggaacattctgccttccaggccccacctgtgaaaaggaaaccggccgtg
accaaaggcaggtcttccagaaaaggaacagagaacggtgtgaacggcacagtcacatca
aacggagcagactcccctcggaacaggaaagagaagtcttcgtaa

DBGET integrated database retrieval system