KEGG   Mus musculus (mouse): 229927
Entry
229927            CDS       T01002                                 

Gene name
Clca3b, Clca4
Definition
(RefSeq) chloride channel accessory 3B
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04924  Renin secretion
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    229927 (Clca3b)
  09154 Digestive system
   04972 Pancreatic secretion
    229927 (Clca3b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    229927 (Clca3b)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   229927 (Clca3b)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_3 MG2 VWA_CoxE
Other DBs
NCBI-GeneID: 229927
NCBI-ProteinID: NP_631887
MGI: 2181989
Ensembl: ENSMUSG00000037033
Vega: OTTMUSG00000030497
UniProt: E9PUL3 Q91ZF5
Position
3; 3 H2
AA seq 1044 aa
MVPGLQVLLFLTLHLLQNTESSMVHLNSNGYEGVVIAINPSVPEDERLIPSIKEMVTQAS
TYLFEATERRFYFRNVSILVPITWKSKTEYLTPKQESYDQADVIVADPHLQHGDDPYTLQ
YGQCGDRGQYIHFTPNFLLTDNLGIYGPRGRVFVHEWAHLRWGVFDEYNMDRPFYMSRKN
TVEATRCSTDITGTSVVRECQGGSCVSRRCRRDAKTGMQEAKCTFIPNKSQTARGSIMFM
QSLDSVVEFCTEKTHNVEAPNLQNKMCNLRSTWDVIKASADFQNASPMTGTEAPPLPTFS
LLKSRQRVVCLVLDKSGSMRLGSPITRLTLMNQAAELYLIQIIEKESLVGLVTFDSTATI
QTNLIRIINDSSYLAISTKLPQYPNGGTSICNGLKKGFEAITSSDQSTSGSEIVLLTDGE
DNRISSCFQEVKHSGAIIHTIALGPSAARELETLSDMTGGLRFYAKEDVNGLIDAFSGIS
SKSGSISQQALQLESKAFNVGAGAWINSTVPVDSTVGNDTFFVITWTVRKPEIILQDPKG
KNYTTSDFQEDKLNIFSVRLRIPGIAETGTWTYSLLNKGATSQLLTVTVTTRARSPTTLP
VIATAHMSQSTAQYPSRMIVYARVSQGFLPVLGANVTAVIEAESGNQVTLELWDNGAGAD
TLKNDGIYSRYFTDFHGNGRYSLKVNAQARKNMAKLNLKQKNKSLYIPGYVENDQIVLNP
PRPEIPEATEATVEDFSRLTSGGSFTVSGAPPDGDHARVFPPSKVTDLEAEFIGDHIHLT
WTAPGKVLDKGRAYRYVIRMSGHSLALQEDFSNSTLVNTSSVMPKEAGSKETFKFKPETF
KIENGTQVYIAIQADNEARLSSEVSNIAQAVKFIPPQVYLTPSTPPGLSTPSTPPGLSTP
STPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGL
STPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTPPGLSTPSTP
PGLGTKVSVPSLTVFVLVATLFIF
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggtgccagggctgcaggtccttctgttcctcaccctgcatctcctgcagaacacagag
agctccatggtgcatctcaacagcaatggatatgagggtgtggtcattgccattaacccc
agtgtgccggaggacgaaaggctcatcccaagcataaaggaaatggtaactcaagcctcc
acttacctgtttgaagccacagaaagaagattttatttcagaaacgtgagcattttagtt
cccataacctggaagtcaaaaactgagtacttaacaccaaaacaagaatcatatgaccaa
gcagacgtcatagttgccgatcctcacctgcaacatggagacgacccctacacccttcag
tacggacagtgtggggacagaggacagtacatacacttcactccaaacttcctactcact
gataacttgggtatctacggaccccgaggcagagtctttgtccatgagtgggcccatctc
cggtggggagtatttgatgagtataacatggaccggcctttctacatgtctagaaagaac
actgtcgaagcaacaaggtgttccaccgacatcactggcaccagtgtggtccgtgagtgt
cagggaggcagctgtgtgtcgaggagatgtcgtcgagatgcaaagacaggaatgcaggaa
gccaagtgtacatttatcccaaacaaatcccagactgcgaggggctccatcatgttcatg
caaagtctcgattctgtggttgaattctgcacagaaaaaacccacaatgtagaagctcca
aacctacaaaacaaaatgtgcaatctcagaagcacgtgggatgtaatcaaggcgtctgct
gactttcagaatgcctctcccatgacaggaacagaagcccctcccctgcctacattttca
ctgctcaaatccagacagcgagtggtctgcttggtgctggataaatctggaagcatgcgc
ttaggaagccccatcactcgtctgaccctaatgaaccaagcagcagagctatacttaatt
caaattattgaaaaggaatccttggtcggcctggtgacatttgatagcactgccacaatc
caaactaacctaataaggatcatcaatgacagctcctacctagcgatcagcacaaagctg
cctcaatacccaaatggcggaacttcaatttgcaacggactcaaaaaaggattcgaggca
attacctccagtgaccagagcacttccggttctgagatcgtattgctaacagatggggaa
gataatagaataagctcgtgctttcaggaggtcaaacacagtggagccatcatccacacc
atcgcgctggggccttctgctgcgcgagaactggagactctgtcagacatgacaggaggg
cttcgattttatgccaaggaagacgtgaatggcctgattgatgctttcagtgggatctca
tctaaaagtggcagcatctcacagcaggctctgcagttggagagcaaagccttcaatgtc
ggagcaggggcatggataaacagtacagtacctgtggacagtaccgtcggcaacgacacg
ttctttgttatcacctggacagtaagaaagccagaaatcattcttcaagatccaaaagga
aaaaactacaccacctccgatttccaggaagataagctaaatatcttctctgttcgcctt
cggatcccaggcattgctgagacaggcacttggacttacagcctcttaaataagggtgcc
acatctcagttgctaacagtgacagtgaccactcgagcaagaagtcccaccacactccca
gtcatcgccaccgctcacatgagtcagagcacagcccagtaccctagccggatgattgtg
tatgcaagggtcagccaagggtttttgcctgttctgggagccaatgtcacagccgtcata
gaagctgagagtggaaatcaagtcaccctggagctctgggacaacggggcaggtgctgac
acactcaaaaatgacggcatctactcaagatatttcacagacttccatggaaatggcaga
tacagcttaaaagtcaatgcccaggcaagaaagaacatggctaaactaaatctgaaacaa
aagaataagtctctctatatacctggctacgttgaaaatgatcaaattgtactgaatcca
cccagaccggaaatcccagaagccacagaagctacagtggaagacttcagcagactaacc
tctggaggatcgtttactgtgtctggagcgccccctgatggcgatcacgctcgtgtgttt
ccaccaagtaaagtcacagacctggaggctgagtttataggtgatcatattcaccttaca
tggacggcccctggcaaggtcctcgataagggaagagcatatagatacgtcatcaggatg
agtgggcattctctggctctccaagaagattttagcaactctactttagtgaatacttcc
agtgtaatgcctaaagaggctggctcaaaagaaacatttaaattcaaaccagaaactttt
aaaatagaaaatggcacccaagtctacattgcaatccaggctgacaatgaagcccgtctc
tcctctgaggtctccaacattgcacaggctgtgaagtttattcctccacaagtttatttg
acacccagcacccctcctggtctgagtacccccagcacccctcctggtctgagtaccccc
agcacccctcctggtctgagtacccccagcacccctcctggtctgagtacccccagcacc
cctcctggtctgagtacccccagcacccctcctggtctgagtacccccagcacccctcct
ggtctgagtacccccagcacccctcctggtctgagtacccccagcacccctcctggtctg
agtacccccagcacccctcctggtctgagtacccccagcacccctcctggtctgagtacc
cccagcacccctcctggtctgagtacccccagcacccctcctggtctgagtacccccagc
acccctcctggtctgagtacccccagcacccctcctggtctgagtacccccagcacccct
cctggtctgggtaccaaagtgtccgtacccagtttgacagtttttgtacttgttgcaact
ttattcatattttaa

DBGET integrated database retrieval system