KEGG   Mus musculus (mouse): 230073Help
Entry
230073            CDS       T01002                                 

Gene name
Ddx58, 6430573D20Rik, C330021E21, RIG-I, RLR-1
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
  KO
K12646  ATP-dependent RNA helicase DDX58 [EC:7.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    230073 (Ddx58)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    230073 (Ddx58)
   04623 Cytosolic DNA-sensing pathway
    230073 (Ddx58)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    230073 (Ddx58)
   05164 Influenza A
    230073 (Ddx58)
   05161 Hepatitis B
    230073 (Ddx58)
   05160 Hepatitis C
    230073 (Ddx58)
   05168 Herpes simplex infection
    230073 (Ddx58)
   05169 Epstein-Barr virus infection
    230073 (Ddx58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    230073 (Ddx58)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Hydron translocation linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     230073 (Ddx58)
Pattern recognition receptors [BR:mmu04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   230073 (Ddx58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C ResIII DEAD AAA_25 AAA_22 ATP-synt_ab ApoLp-III
Motif
Other DBs
NCBI-GeneID: 230073
NCBI-ProteinID: NP_766277
MGI: 2442858
Ensembl: ENSMUSG00000040296
Vega: OTTMUSG00000006554
UniProt: Q6Q899 A1L0V6
Structure
PDB: 

Position
4; 4 A5
AA seq 926 aa AA seqDB search
MTAEQRQNLQAFRDYIKKILDPTYILSYMSSWLEDEEVQYIQAEKNNKGPMEAASLFLQY
LLKLQSEGWFQAFLDALYHAGYCGLCEAIESWDFQKIEKLEEHRLLLRRLEPEFKATVDP
NDILSELSECLINQECEEIRQIRDTKGRMAGAEKMAECLIRSDKENWPKVLQLALEKDNS
KFSELWIVDKGFKRAESKADEDDGAEASSIQIFIQEEPECQNLSQNPGPPSEASSNNLHS
PLKPRNYQLELALPAKKGKNTIICAPTGCGKTFVSLLICEHHLKKFPCGQKGKVVFFANQ
IPVYEQQATVFSRYFERLGYNIASISGATSDSVSVQHIIEDNDIIILTPQILVNNLNNGA
IPSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRDPLPQVVGLTASVGVGDAKT
AEEAMQHICKLCAALDASVIATVRDNVAELEQVVYKPQKISRKVASRTSNTFKCIISQLM
KETEKLAKDVSEELGKLFQIQNREFGTQKYEQWIVGVHKACSVFQMADKEEESRVCKALF
LYTSHLRKYNDALIISEDAQMTDALNYLKAFFHDVREAAFDETERELTRRFEEKLEELEK
VSRDPSNENPKLRDLYLVLQEEYHLKPETKTILFVKTRALVDALKKWIEENPALSFLKPG
ILTGRGRTNRATGMTLPAQKCVLEAFRASGDNNILIATSVADEGIDIAECNLVILYEYVG
NVIKMIQTRGRGRARDSKCFLLTSSADVIEKEKANMIKEKIMNESILRLQTWDEMKFGKT
VHRIQVNEKLLRDSQHKPQPVPDKENKKLLCGKCKNFACYTADIRVVETSHYTVLGDAFK
ERFVCKPHPKPKIYDNFEKKAKIFCAKQNCSHDWGIFVRYKTFEIPVIKIESFVVEDIVS
GVQNRHSKWKDFHFERIQFDPAEMSV
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggagcagcggcagaatctgcaagcattcagagactatatcaagaagattctg
gaccccacctacatcctcagctacatgagttcctggctcgaggatgaggaggtgcagtac
attcaggctgagaagaacaacaagggcccaatggaagctgcctcactcttcctccagtac
ctgttgaagctgcagtcagagggctggttccaggcctttttggatgccctgtaccatgca
ggttactgtggactttgtgaagccatcgaaagttgggactttcaaaaaattgaaaagtta
gaggaacacagattacttttaagacgtttagaaccagaatttaaggccacagttgatcca
aatgatatcctttctgaactatccgaatgtttgattaatcaggaatgtgaagaaatcaga
cagatccgagacactaaagggagaatggcaggtgcggagaagatggccgaatgtcttatc
agatccgacaaggaaaactggccaaaggtcttgcaacttgctttggagaaagacaacagc
aagtttagtgaattgtggattgttgataaaggtttcaaaagggctgaaagcaaggctgat
gaggatgatggagcggaggcgtccagcatccagattttcattcaggaagagccagagtgt
cagaatctcagtcagaatcccgggcctccttcagaagcgtcttctaataatttacacagc
ccattgaaaccaagaaattaccaactggagcttgccctgcctgccaagaaagggaaaaat
acaataatatgtgcccctactggttgtggaaaaacctttgtgtcgcttcttatatgtgaa
caccatcttaaaaaattcccatgtggacaaaaagggaaagtggtcttcttcgctaaccaa
attcctgtctatgagcagcaggcaactgtgttctcacgatattttgaaagacttgggtac
aacattgcgagcatttctggggcaacatctgatagcgtctcagtgcagcacatcattgaa
gacaatgatatcatcatcctgacaccccagattcttgtgaacaatctcaacaacggagcc
atcccctcgttgtctgtcttcactctgatgatatttgatgagtgtcataacactagcaaa
aaccacccatacaatcagatcatgttcagatacctagaccacaaacttggagagtcacgg
gacccactgcctcaggtcgttgggctgactgcctccgtcggcgttggagatgctaagacc
gcggaggaagccatgcaacatatctgtaaactctgtgccgccctggatgcctccgtgatt
gccacagtcagagacaacgttgcagaactggaacaggtcgtttataagccccagaaaatt
tccaggaaagtggcatcccggacttcgaacacgtttaaatgcatcatctctcagctgatg
aaggagacagagaagctagccaaggatgtctccgaggaacttggaaagctttttcaaatt
caaaacagagaattcggcacccagaaatatgaacagtggattgtcggcgtccacaaagcg
tgctcagtgtttcagatggcagacaaagaggaggagagccgggtctgcaaagcgctcttc
ctgtacacatcacatttgcggaaatacaacgatgcactcatcatcagtgaggatgcacag
atgacagacgctctaaattacctcaaagccttcttccacgatgtccgagaagcagcattc
gatgagaccgagcgagagcttactcggaggtttgaagaaaaactagaggaattagaaaaa
gtttccagggatcccagcaatgagaatcctaaactaagagacctctacttggtcttacaa
gaagagtaccacttaaagccagagaccaagaccattctcttcgtgaagaccagagcactc
gtggatgctctgaagaaatggattgaagaaaatcctgcactaagctttctaaagcctggc
atactgactgggcgtggcagaacaaaccgggcaacaggaatgacgctcccggcacagaag
tgtgtgctggaggcattcagagccagcggagataacaatattctgattgctacctcggtc
gctgatgaaggcattgacattgctgagtgcaatctcgtcattctctatgagtacgtgggc
aacgtcatcaagatgatccaaaccagaggccgaggaagagcacgagatagcaagtgcttc
ctcctgaccagcagcgctgacgtgattgaaaaagaaaaggcgaacatgatcaaggaaaaa
ataatgaatgaatccatcttaagactgcagacatgggatgaaatgaaatttggaaagacg
gttcaccgcatacaggtgaatgaaaaactcctcagagacagtcagcacaaaccacaacct
gttcctgacaaagaaaacaagaaactgctgtgtggaaagtgcaagaattttgcgtgctac
acagctgacattcgagtggttgagacgtcccactacactgtccttggagacgcttttaag
gagcgctttgtgtgtaagccacaccctaaaccaaagatctatgacaattttgagaagaaa
gcaaagatattctgcgccaaacagaactgtagccacgactggggaatttttgtgagatac
aagacgttcgagattccagtcataaaaattgaaagtttcgtcgtggaagatattgtgagc
ggagttcagaaccggcactcaaagtggaaggactttcattttgaaaggatacagttcgat
cctgcagaaatgtccgtatga

DBGET integrated database retrieval system