KEGG   Mus musculus (mouse): 230099Help
Entry
230099            CDS       T01002                                 

Gene name
Car9, CAIX, Ca9, MN/CA9
Definition
(RefSeq) carbonic anhydrase 9
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    230099 (Car9)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     230099 (Car9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase DUF4730
Motif
Other DBs
NCBI-GeneID: 230099
NCBI-ProteinID: NP_647466
MGI: 2447188
Ensembl: ENSMUSG00000028463
Vega: OTTMUSG00000006931
UniProt: Q8VHB5 Q3UUZ9
Position
4; 4 A5
AA seq 437 aa AA seqDB search
MASLGPSPWAPLSTPAPTAQLLLFLLLQVSAQPQGLSGMQGEPSLGDSSSGEDELGVDVL
PSEEDAPEEADPPDGEDPPEVNSEDRMEESLGLEDLSTPEAPEHSQGSHGDEKGGGHSHW
SYGGTLLWPQVSPACAGRFQSPVDIRLERTAFCRTLQPLELLGYELQPLPELSLSNNGHT
VQLTLPPGLKMALGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSE
LHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEISEEGSKIEIPGLDVSALLPSDL
SRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGPRDSRLQLNFRATQPL
NGRTIEASFPAAEDSSPEPVHVNSCFTAGDILALVFGLLFAVTSIAFLLQLRRQHRHRSG
TKDRVSYSPAEMTETGA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctgggccccagcccctgggcccctttgtcgaccccagcccctactgcacag
ctgctgctgttcctgctgctccaagtgtctgctcagccccagggcctgtccgggatgcag
ggggagccctccttgggagacagttcatctggggaggatgagctgggcgtggatgttctg
cccagtgaagaggatgcacctgaagaggcggatccacccgatggggaggatccacctgaa
gttaattctgaagacaggatggaggagtcccttgggttagaggatctatcgactcccgag
gctcctgagcacagtcaaggttcccacggggatgaaaaagggggtggccacagtcattgg
agctatggaggcaccctactctggccccaggtgtccccagcctgtgctggccgctttcag
tccccggtagacatccgcctggagcgcaccgcattctgccgcactctgcaacccctggaa
cttctgggttatgagctccagcctctcccggaactgagcctatccaacaatggccacacg
gtacagctgactctgccgccggggctgaagatggctctgggacctgggcaggaataccgg
gccttgcagttgcatctacactggggaacttcagatcacccaggctcagaacacacagtc
aatggtcaccgtttccctgctgagatccacgtggtgcacctcagtactgctttctccgaa
cttcatgaagccttgggccgcccaggaggcctggcagttttggctgcctttctgcaggag
agcccagaagaaaacagtgcttacgaacagttgctgtcccatttggaagaaatctcggag
gaaggctccaagattgagatcccaggtttggatgtatctgcactgttgccctcggacctc
agccgctactaccgatatgaagggtctctgaccacacctccctgcagccagggggtcatc
tggactgtgttcaatgagacagtgaaactgagcgctaagcagctccatactctctccgtt
tccttgtggggacctcgtgattctcggctacaactgaacttccgagccacgcaacccttg
aatgggcgaacgattgaggcttccttccctgctgcagaggatagcagccctgagccagtc
catgtgaattcctgcttcactgctggtgacatcctagccttggtgtttggccttctcttt
gctgtcaccagcatcgccttcctcctacagctgaggaggcagcacaggcacagaagtggg
accaaagatagagttagctacagtccggcagagatgacagaaactggagcctaa

DBGET integrated database retrieval system