KEGG   Mus musculus (house mouse): 230103
Entry
230103            CDS       T01002                                 
Symbol
Npr2, GC-B, GC-B2, GC-B3, cn, mNPR-B, pwe
Name
(RefSeq) natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    230103 (Npr2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    230103 (Npr2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    230103 (Npr2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    230103 (Npr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    230103 (Npr2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     230103 (Npr2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   230103 (Npr2)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA
Other DBs
NCBI-GeneID: 230103
NCBI-ProteinID: NP_776149
MGI: 97372
Ensembl: ENSMUSG00000028469
UniProt: Q6VVW5
Position
4:43629015..43651437
AA seq 1047 aa
MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSDRYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPTERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGEQKGPPGLL
NT seq 3144 nt   +upstreamnt  +downstreamnt
atggcactgccatccctgctgctggtggtggcagccctggcaggtggggtgcgtcctccg
ggggcacggaacctgacgctggcggtggtgctgccagaacacaacctgagctatgcctgg
gcctggccacgggtgggtcctgctgtggcactggctgtggaggcactgggccgggcactg
cccgtggacctgcggtttgtcagctccgaactagacggcgcctgctctgagtacctggca
ccactgcgcgctgtggacctcaagctgtaccatgaccccgaccttctgttgggccccggt
tgtgtgtaccccgctgcctctgtggctcgctttgcctcacactggcgccttcccctcctg
actgcgggggcagtggcctctggctttgcagctaagaatgagcattatcgtaccctggtt
cgcactggcccctctgcgcccaagctgggtgagtttgtagtgacattgcacgggcacttc
aattggacagctcgggctgctttgctgtatctggatgctcgcacagatgaccggccccac
tacttcaccatcgagggcgtctttgaggccctgcagggcagcaacctcagtgtgcagcac
caggtgtatgcccgagagccaggtggccctgagcaagccacccacttcatcagagccaac
gggcgcattgtgtatatctgcggccccctggaaatgctgcatgagatcctgcttcaggcc
cagagggagaacctgaccaatggggactatgtcttcttttaccttgatgtctttggggag
agtctccgagcaggccccacccgtgcaacaggccggccatggcaggacaatcgaacccag
gaacaggcccaggccctcagagaggcctttcagactgtattggtgatcacataccgagaa
cccccaaatcctgagtatcaggagtttcagaatcgcctgctgatcagagcccgggaagac
tttggtgtggagctggccccatccctgatgaaccttattgctggctgcttctatgatggg
atcctgctctatgcccaagtcctgaatgagactatacaggaagggggtaccagggaagat
ggacttcgaattgtggagaagatgcagggacgaagataccatggtgtaactggactggtt
gtcatggacaagaacaatgaccgcgagactgatttcgtcctgtgggccatgggagacttg
gattctggggactttcagcccgcagcccattactctggagcagagaagcagatttggtgg
acaggccggccaattccctgggtgaagggggccccacctttggacaatcccccctgtgcc
tttgacttggacgacccatcctgtgataaaactccactttccactctggcaatcgtggcc
ctgggcacgggagtcaccttcatcatgtttggtgtttccagtttcctaattttccggaag
ctgatgctggagaaggagctggctagcatgctatggcgcattcgctgggaagaactgcag
tttggcaactcggatcgctatcacaagggtgcaggcagtcgcctgacgctgtcgctgcgg
ggatccagttacggctcgctcatgacagcccatgggaaataccagatctttgccaacacc
ggtcacttcaagggaaatgttgttgccatcaaacacgtgaataagaagcgcatcgagctg
acccggcaagttctgtttgaactcaaacacatgagagatgtccagttcaaccatcttact
cgcttcatcggagcctgcatagaccctcccaacatctgcattgtcaccgagtattgtcct
cgtgggagcttacaagatattctagaaaatgacagcatcaatttggactggatgtttcgc
tactcgctcatcaatgaccttgtgaagggtatggcctttctccacaacagcattatttca
tctcatggaagcctcaagtcctccaactgtgtggtggatagtcgatttgtgctcaaaata
acagattacggtctggctagtttccgatcaactgctgaaccggacgacagccatgccctc
tatgccaagaagctgtggactgccccagaactgcttagcgggaaccccttgccaaccaca
ggcatgcagaaagcagatgtctacagctttgccatcattctacaggaaatagcacttcga
agtggtcctttctacttggaaggcctggacctcagtcccaaggagattgtccagaaggtg
cggaatggtcagaggccgtatttccggccaagcattgaccggacacaactgaatgaagag
ttagttttgctgatggagagatgctgggcccaggacccaacagaacgtccagactttggg
caaatcaagggcttcattcgccggtttaacaaggaaggtggtaccagcatattggacaac
ctcttgctgcgcatggaacagtatgctaataacctggaaaagctggtggaggaacgcaca
caggcctatctagaggagaaacgcaaagcggaggccctgctgtaccaaattctaccccat
tctgtagcagagcagttaaagcggggagagacggttcaggcggaggccttcgacagcgtc
accatctacttcagtgacatcgtgggcttcacagcgctgtcagctgagagcacccccatg
caggtggtgacacttcttaatgacctttatacctgctttgatgccattatcgacaacttt
gatgtctacaaggtggaaaccattggggatgcctacatggtggtatctggccttccaggc
cgaaacggtcagcgccatgcaccagaaattgctcgaatggccctagcattgctagatgct
gtctcttccttccgcatccgccatcgaccccatgaccagctgaggttacgcataggtgtc
catactgggccagtctgtgctggggtggttggcctgaagatgccccggtactgtcttttt
ggagacacagtaaacactgcttctcgaatggagtcgaatggccaagctctaaagatccat
gtctcctcgaccaccaaggacgccctggatgagctgggatgcttccagctcgagctccgt
ggggatgtggagatgaagggaaaaggaaaaatgcgaacttactggctcttgggagagcaa
aagggacctcccggactcctgtaa

DBGET integrated database retrieval system