KEGG   Mus musculus (mouse): 230145
Entry
230145            CDS       T01002                                 

Symbol
Galnt12, 9130206E10, A630062B03Rik, galNAc-T12, mpp-GalNAc-T12, pp-GaNTase
Name
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 12
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    230145 (Galnt12)
   00514 Other types of O-glycan biosynthesis
    230145 (Galnt12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    230145 (Galnt12)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     230145 (Galnt12)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  Mucin-type
   230145 (Galnt12)
SSDB
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2 RicinB_lectin_2
Other DBs
NCBI-GeneID: 230145
NCBI-ProteinID: NP_766281
MGI: 2444664
Ensembl: ENSMUSG00000039774
Vega: OTTMUSG00000006777
UniProt: Q8BGT9 Q60GT3
Position
4; 4 B1
AA seq 576 aa
MWGRAVRRRCPRGLRRGREALLALLALAGLGALLRARSRSGTVDPGPPRTPLPGRHEPVL
PRPPLPADALGAHGEAVRLQLQGEELRLQEESVKQHQINIYLSDRISLHRRLPERWNPLC
REVKYDYDNLPKTSVVIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDREHLKE
RLANELSQLPKVRLIRASRREGLVRARLLGASAARGEVLTFLDCHCECHEGWLEPLLQRI
HEKESAVVCPVIDVIDWNTFEYLGNSGEPQIGGFDWRLVFTWHVVPQRERQSMRSPIDVI
RSPTMAGGLFAVSKRYFDYLGSYDTGMEVWGGENLEFSFRIWQCGGTLETHPCSHVGHVF
PKQAPYSRSKALANSVRAAEVWMDEFKELYYHRNPQARLEPFGDVTERKKLRAKLQCKDF
KWFLDTVYPELHVPEDRPGFFGMLQNRGLRGYCLDYNPPNENHVEGHQVLLYLCHGMGQN
QFFEYTTRKEIRYNTRQPEACITVEDGKDTLVMDLCRETVPENQEFILQEDGTLVHKHSR
KCVEATEKVLDNGFAPYLRDCTNSDNQRWFFKERMS
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgtgggggcgtgcggtgaggaggcgctgcccgcgggggctgcggcgcggccgggaggcg
ttgctggcactgctggccctggcagggctgggcgcgctgctgcgggctcgaagcaggtcg
gggacggtggacccgggacccccgcggactcctctccccgggcgtcacgagccagtgctg
cccaggccgccgctgcccgccgatgctctgggagcgcatggggaggcggtgcggctgcag
ctgcagggcgaggagctgcggctgcaggaggagagcgtgaagcagcaccagatcaacatc
tatctgagcgaccgtatctcgctgcaccgccgactgcccgagcgctggaaccctctgtgc
agagaggtgaaatacgattatgataacctgcccaagacttctgttgtcatagcattttat
aatgaagcctggtccacactccttcggacagtttacagtgttcttgagacctcccctgac
atcctgctggaggaggtcattctggtagatgactacagcgacagagagcacctaaaggaa
cgcttggccaacgagctgtcacagctccccaaggtgcgcctgatccgtgctagcaggaga
gagggcctagtgcgagcccggctactgggagcctctgcggccaggggcgaagtgctgacc
ttcctagactgtcactgtgaatgtcatgaggggtggctggagcctctgctgcagaggatc
cacgagaaggagtccgcagtcgtgtgccctgttatcgatgtgattgactggaacaccttt
gagtacctgggcaactcgggagagccgcagattggcggctttgactggcggctggtattc
acgtggcacgtggttccccagcgggagcggcagtcgatgcggtcgccgatcgatgttatc
aggtctccaactatggctgggggcctgtttgctgtgagtaagagatattttgattatctg
gggtcttacgatacaggaatggaagtctggggaggagaaaaccttgagttctcctttagg
atctggcagtgtggtggcactctggaaacgcacccgtgctcccatgtgggccacgtcttc
cctaagcaagctccctattcccgtagcaaggccctggccaacagtgtccgagctgcagaa
gtgtggatggatgaatttaaagaactctactaccaccgcaatccccaggcccgcctggaa
ccctttggggacgtgacagagaggaagaagcttcgggctaagctccagtgtaaagacttc
aagtggttcttagatacagtgtacccagaattgcacgtgccagaggacaggcctggcttc
tttgggatgctccagaacagaggcctaagagggtactgccttgactacaatcctcccaat
gaaaaccatgttgaaggccaccaggtccttctgtacctctgccatgggatgggtcagaac
cagtttttcgagtatacgacccggaaagaaatacgctataacacccgccagcccgaagcc
tgcatcaccgtggaggacgggaaggatacccttgtcatggatctctgccgagagaccgtc
ccagagaaccaggagttcatcctacaggaggatggcactttagttcacaagcacagcagg
aaatgtgtggaggccacagagaaggtgttagacaacggctttgcaccatacttacgggac
tgtaccaactcagataaccagaggtggttcttcaaggagcgcatgtcgtag

DBGET integrated database retrieval system