KEGG   Mus musculus (house mouse): 230162
Entry
230162            CDS       T01002                                 
Symbol
Zfp189, BB131811, C430015I23Rik
Name
(RefSeq) zinc finger protein 189
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    230162 (Zfp189)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    230162 (Zfp189)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    230162 (Zfp189)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_6 KRAB zf_UBZ zf-C2H2_jaz zf-C2H2_11 zinc_ribbon_15 Zn_ribbon_SprT zf-C2HC_2
Other DBs
NCBI-GeneID: 230162
NCBI-ProteinID: NP_001276830
MGI: 2444707
Ensembl: ENSMUSG00000039634
UniProt: Q8BKP2 Q8BKW8
Position
4:49521176..49531558
AA seq 608 aa
MASPSPPLEPKEEWGYLDPAPRSLYKDVMMDSYGKLVSLDVLNRNKDEEPTVKEELEKDI
EPQGVIVTRIKSEIDQDPVGSETFELVGRLDKQRGIFLWEIPRDSLSEEQKLFRGHTNVR
KRPTSEEKCHKCEECGKRFVRKAHFIQHQRVHTGEKPFQCNECGKSFSRSSFVIEHQRIH
TGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQSFSQRRSLVKHQRIHTGEK
PHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGERPHKC
GECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLIEHQRIHTGERPYQCQECG
KSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQRIHIREKTSPFSETKESFD
PNCSLVIQQEVSPKEKSYKCDDCGKTFSVSAHLVQHQRIHTGEKPYLCTVCGKSFSRSSF
LIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPHKCEECGKAFSRNSGLIQH
QRIHTGEKPYRCGKCDKSFSQQRSLVNHQKIHAEVKTQEIYECDACGEAFTCQISLIQHQ
KLHIMWMQ
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcgtccccaagcccaccgctggagccaaaggaggagtggggttatctggatccagct
ccgagaagcctgtataaagatgtcatgatggacagctacggaaagctggtctcgctggat
gttttaaacagaaataaagatgaagagccaactgtgaaagaagaacttgagaaagatatc
gagccacagggtgtaatagttacaagaatcaaaagtgaaattgatcaagatcctgtgggt
agcgaaacctttgaacttgttggtaggttagataaacaaagagggatctttttgtgggaa
ataccacgtgactctctgagtgaggaacagaaactatttagagggcacactaatgtccgt
aagagaccaacttcagaagagaagtgtcataaatgtgaagaatgtggaaaacgttttgtc
cgcaaggcccatttcattcagcatcaaagggtccacacgggtgagaaaccttttcagtgc
aacgagtgtgggaaaagcttcagtcgaagttcctttgttattgaacatcagagaattcac
actggggaacgaccctatgagtgtaattactgtgggaaaacctttagtgtgagctctacc
cttattagacaccagagaatccacactggagaaaggccttaccagtgtaatcagtgtaaa
cagagcttcagccagagaaggagccttgtgaaacaccaaagaattcacactggtgagaaa
ccccataaatgcagtgactgtggaaaagccttcagttggaaatcccaccttattgagcat
cagaggacccacactggtgagaaaccctatcactgtaccaaatgcaagaaaagttttagt
cgaaactcattgcttgttgaacaccagagaattcataccggagaaagacctcataagtgt
ggtgaatgtgggaaagcgttcagattaagtacataccttatacaacaccaaaaaatacac
actggtgagaagccttttctttgtattgaatgtggaaagagtttcagtcggagctcattc
cttattgaacatcagaggatccatacgggggaacgcccttatcagtgccaagagtgcggg
aaaagtttcagtcaactttgcaaccttacccgtcatcagagaattcacacgggggacaaa
ccccacaagtgtgaggagtgtgggaaagccttcagtagaagctcaggtctcattcagcac
cagagaatccatatcagggaaaagacttcgccattcagtgaaactaaggaaagttttgat
ccaaactgcagtctggttatacagcaggaagtctcccctaaggagaaatcgtacaaatgc
gatgactgtgggaaaacgttcagtgtcagtgctcatcttgtacagcatcagaggatccac
actggtgagaagccctacctgtgtactgtctgcgggaaaagcttcagtcggagctcgttt
cttattgagcatcagagaatccacactggggagagaccctatctgtgcagacagtgtggc
aaaagttttagtcaactttgtaatctcatccgccatcagggcgttcacactggtaacaag
ccccacaagtgtgaggagtgtgggaaagccttcagcaggaactcaggtctcattcagcac
cagagaatccacacaggagagaagccttataggtgtggaaaatgtgacaaaagttttagt
caacagcgcagccttgtcaaccatcagaagatccatgcagaggtgaaaacccaggaaatt
tatgaatgtgatgcctgcggcgaagcctttacttgtcagatttctctaattcagcatcaa
aagttgcatattatgtggatgcagtaa

DBGET integrated database retrieval system