KEGG   Mus musculus (mouse): 230257Help
Entry
230257            CDS       T01002                                 

Gene name
Ptbp3, 5830471K22Rik, AA407443, AI462022, AW107884, C86549, Rod1
Definition
(RefSeq) polypyrimidine tract binding protein 3
  KO
K17844  polypyrimidine tract-binding protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    230257 (Ptbp3)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    230257 (Ptbp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_5 RRM_1 RRM_8 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 230257
NCBI-ProteinID: NP_835458
MGI: 1923334
Ensembl: ENSMUSG00000028382
Vega: OTTMUSG00000007334
UniProt: Q8BHD7
Position
4; 4 B3
AA seq 523 aa AA seqDB search
MNSSTSAGVYANGNDNKKFKGDRPPCSPSRVLHLRKIPCDVTEAEVISLGLPFGKVTNLL
MLKGKSQAFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQA
ALQAVSAVQSGNLSLPGATANEGTLLPGQSPVLRIIIENLFYPVTLEVLHQIFSKFGTVL
KIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDK
SRDFTRLDLPTGDGQPSLEPPMAAAFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVP
GALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVK
IMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTK
DFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQ
KDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctcgacttctgcaggtgtgtatgctaatgggaatgacaacaagaaatttaaa
ggagatagacctccctgttcgccttcccgtgttctccatcttcgaaaaattccatgtgat
gtcaccgaagcagaggtcatatcattaggtctaccatttggcaaagtaactaatcttttg
atgttgaaaggaaaaagccaggcctttttagaaatggcttctgaagaagctgctgttact
atgataaattattacactcctgttactcctcatcttcgaagtcagcctgtttatatccag
tattccaatcaccgagaacttaagactgacaatctgcctaatcaggctagagcccaagct
gcactgcaggctgtcagtgcagtccagtcaggaaacttgtcccttcctggagctactgca
aatgaaggcacattgctacctgggcagagccctgtgctccggataattattgaaaaccta
ttttaccctgtcactctggaagttctccatcagatattttctaaatttggcacggtgttg
aagattatcacctttacaaagaataatcagtttcaagccttgcttcagtatgccgaccca
gtgaatgcgcagtatgccaaaatggctctggatggccagaatatctacaatgcgtgctgc
actctccgtattgacttctccaagctcaccagccttaatgtgaaatacaataatgacaaa
agcagagacttcactcgcttagaccttcctactggtgacggccagccatctcttgaacct
cctatggctgctgcttttggtgcaccgggtataatgtcctctccatatgcaggggctgct
ggctttgccccagccatcgcatttcctcaagcagcaggtctgtctgtcccagctgttccc
ggagcccttggtcctctcacacttacctcctctgctgtcagtggaaggatggccattcct
ggggcaagtggtatgcctgggaattctgttctgctggtcaccaacctcaatcctgacttt
atcacaccacatgggctttttatcctatttggagtgtatggtgatgtacatcgagtgaag
attatgtttaacaagaaagaaaacgccttggtgcagatggcggatgcgagtcaagcccag
ctagcaatgaaccacctaagtggtcagaggctctatggaaaagtacttcgggctacactg
tccaaacatcaagccgtccagctccctagagagggacaggaagaccaaggtctgaccaag
gacttcagcaatagtcccctgcatcgctttaaaaagcccggctcaaagaatttccaaaat
atcttccctccatcagccacacttcatctttccaacattcctccttctgtcacaatggat
gacctgaagaacctgttcacagaagctggatgctcagtgaaggcttttaagttcttccag
aaagaccgtaagatggctctcattcagttgggatctgtggaagaagcaatccaggctctt
attgagcttcacaatcatgaccttggagagaatcaccacctcagagtttccttctcaaaa
tccaccatctga

DBGET integrated database retrieval system