KEGG   Mus musculus (mouse): 230279
Entry
230279            CDS       T01002                                 

Symbol
Tmem268, 6330416G13Rik, AW492431, bM230C2.2
Name
(RefSeq) transmembrane protein 268
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4481 DUF2157
Other DBs
NCBI-GeneID: 230279
NCBI-ProteinID: NP_659154
MGI: 1913920
Ensembl: ENSMUSG00000045917
Vega: OTTMUSG00000000250
UniProt: Q8R239
Position
4; 4 B3
AA seq 342 aa
MACEPPTDPGGAAGPLPTSTLGCNILPQGNPPGWGQELHNGQVLTVLRIDNTCAPISFDL
GAAEEQLQAWGIQVPAEQYRNLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVLVWANIY
STSQMFALGNQWAGVLLATLAAFSLTLTLVLVFERQQRKANTNTDLRLVAANGALLRHRV
LLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEMKRSQESLLRSRLSQLCVVMETG
VSPVVEGPEDLEDAPLLPSTPGPQERPLTQTELYQLVPEAEPEEMARQLLAVFGGYYTRL
LVTSRLPQSMGTRHMDSARIPCPCQLIEVHVLGTGCCPFLAR
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcttgtgagcctcccacagatcctggtggggcagctggtcccctgcccacctctacc
cttggctgcaacatcctgcctcaggggaaccctcctggctgggggcaagagctacacaat
ggccaggtcctcacagtcctccggatcgacaatacctgtgcacctatctcctttgacctg
ggagctgcagaagagcaactgcaggcctggggcattcaggtccctgctgagcagtacagg
aacttggctgagagtgcccttttggaacctcaagtgaggaggtacatcatctacaactcc
aggcccatgaggctggcctttgctgtggtgttctacgtgttggtgtgggccaacatctac
tccaccagccaaatgtttgccctgggcaaccagtgggcaggcgtgctgcttgcgaccctg
gctgctttcagcctgaccctgacccttgtgctggtctttgagaggcagcagaggaaggcc
aacactaacacagacctgaggctggtggccgccaatggagcccttctgcgacaccgtgtg
ctgctgggggtgacagacacagtggagggatgccagagtgtgatccagctctggtttgtc
tacttcgatctggagaactgtgtgcagtttttgtccgaccatgttcaagagatgaagagg
agccaagagtccttgctgagaagcagattgagccagctgtgcgttgtcatggagactgga
gtgagccctgtggtggaagggcccgaggatttggaggatgctcccctcctgcccagcact
cctggtcctcaggagaggccactcacacagactgaactctatcagcttgttccagaggct
gagccggaggagatggcccggcagctactggcagtgtttggtggctactacacccggctc
ctggtgacctctcggctccctcagtcaatgggaacgcgacacatggactctgcaaggatc
ccatgcccctgccagctcatagaagtacacgttctgggcacaggatgttgcccgttcctg
gctaggtga

DBGET integrated database retrieval system