KEGG   Mus musculus (house mouse): 230376
Entry
230376            CDS       T01002                                 
Symbol
Haus6, 6230416J20Rik, 9830144E06, D4Ertd27e, mKIAA1574
Name
(RefSeq) HAUS augmin-like complex, subunit 6
  KO
K16589  HAUS augmin-like complex subunit 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    230376 (Haus6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Augmin complex
    230376 (Haus6)
SSDB
Motif
Pfam: HAUS6_N
Other DBs
NCBI-GeneID: 230376
NCBI-ProteinID: NP_775576
MGI: 1923389
Ensembl: ENSMUSG00000038047
Position
4:complement(86497092..86530317)
AA seq 933 aa
MSSARDSAFEKQHLWMYLQALGLDPSSSITFGGKMVPHAHLGENMFDKLNRDAFHIVSYF
LFKTLDEALAKEVFRDCWPPFDQKLDMEFRKHCCEWLKEISAECGSSFPQVVGSLLMSPG
GPKFIHLMYHFARYVAIKYIKTKSNNSLHFAETFNVKPQDMHKCLARSHVARNRFLQILQ
REHYVMQKYQENVNLSVKQVRNARSECMSLQNQIKRMEPYDEKSNTQEKIQKVRSLWASV
NETLMVVEKERDVISSLFGFVNQYALDGAHVAVNIPRLLLDRLEEQICRLQIGNVYEAGK
LNLLTIIHLLNEVLKIMKYEHCKAGQAGLTINLHYLEKETKFQRERLSHMKHMRHKVKET
VTAVRQSIADKEGKWHMKWKGFLGLSPFRLIKDRPAAVDLLPPMSPLTFDPVSEEVYAKS
ILFKYPASLPDSHKEPKQESGSRREVDTPGSVCDGANSPVPFPLQCAASSDTNSSTLLEK
DPNMRTPIEKTLTYKTIADSEEEDSPLSDTAKNSQSSVSRGTLPVKRSEPFQKEQARLVD
EVARVVLSDSPQLSERKEVELEELIDTLISNPFLTRKQIPRTPENLITDIRSSWRKAVET
EDNRSSDGILVDASAREVSSESSSTLHNQREFSLAIFSPDFDRSYFPEEKAVSDQLKGLP
QKHLVTSQIREPPTEDVSDLVNKKMIWKQDLECATTRLSETSHMDVFSPVVGSGIDVMSR
SKEDCVPVPPDHSQASCIEPSTHKTLLWDSFQRLSGIGILHETLPEVGRLSLNSSTSSET
SFNLEPKSYVHSDAFADDVGKGQAIPELDSNLQARLTSYEALKKSLSKIREESYLSNPKT
LEQHKVELSPVAKAVQADDAHTVWDTQDLFIDYAKPSSLVPLDGKTQTVSLTKAFLVEQK
LKTTVPCSLGEFLPSLKEEEISSKSLEARDSLI
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgagctcggcccgggactccgctttcgagaagcagcatctctggatgtacctgcaggcg
ctgggcttggatccgagctccagcatcacgttcggcgggaagatggtgccgcacgcgcac
cttggagagaatatgtttgacaaactgaaccgtgatgcctttcatatagtttcttatttt
ttgtttaaaacattggatgaggctcttgccaaagaagttttcagagattgctggcctcca
tttgaccaaaaacttgacatggaattccggaaacattgctgtgaatggttaaaagagatt
tctgctgaatgtgggagtagttttcctcaagttgttggctcattgcttatgtctcctggt
ggccctaagtttattcatctgatgtatcattttgcaagatatgttgcaatcaaatatatt
aaaacaaaatctaacaattctctacattttgcagaaacatttaatgtaaagccacaagat
atgcacaagtgccttgccagaagccatgtagcacgtaacagatttttacagattttgcaa
agagaacattatgttatgcaaaaataccaggaaaatgtaaatctgtctgttaagcaagta
cgaaatgcaagatcagagtgcatgagtctacagaaccaaattaaaagaatggagccatat
gatgagaagagtaatacacaagagaagattcaaaaggttcggtccttgtgggcttcagtg
aatgagacactcatggttgtggaaaaggagagagacgttattagttcactctttggcttt
gtcaaccagtatgctttggatggagctcatgttgctgttaatattccaaggctcttactt
gacagacttgaggagcagatatgtcggttgcagataggaaatgtttatgaggctggaaaa
ttgaacctcttaacaattattcacttgttaaatgaagtcttgaaaataatgaaatatgaa
cattgtaaggctggccaagcaggattgacaataaatctccactaccttgaaaaagaaacc
aaatttcagagggaaagattatcacatatgaagcatatgaggcataaagtaaaagagacc
gtcactgcagtgagacagtctattgctgacaaggagggaaagtggcatatgaagtggaaa
ggctttcttggcctgtctcctttcagactaattaaagacagacctgcagctgtggatctt
ttgcctcccatgtctcctcttacgtttgatcctgtgtcagaggaagtatatgcaaagagt
atactttttaagtatcctgcttcacttccagattcacataaagaacctaaacaagaaagt
ggtagcagaagagaagtggataccccaggaagtgtgtgtgatggagctaacagccctgtg
ccttttcccttacagtgtgccgcgtcctcagatacaaacagttccacactccttgagaag
gatccaaatatgaggactcccatagagaaaaccttgacatataagacaatagcagactct
gaagaggaagactctcctctatcagatactgcaaagaattcacaaagtagtgtttccaga
gggactctgccggtgaagaggagtgagccattccagaaagagcaagcccgtctggtagat
gaggttgccagagtagttctgtctgattccccacagctctctgagagaaaagaagttgaa
ttggaggagctgattgacactttaatttctaatcccttcttaaccaggaagcaaattccc
cggactccagagaacttgataactgatattaggagctcatggagaaaagctgttgaaact
gaagataacagaagttcagatgggattctagtggatgccagtgctagagaagtgtcgtca
gagtcttcatctacactgcataatcagagggaatttagcctggctattttttccccagat
tttgatcggtcttattttcctgaagagaaagctgtctcagatcagcttaaaggtttacct
cagaaacatctggtaacaagtcagatcagagaacccccaacagaagatgtgtcagacttg
gtaaataagaaaatgatttggaagcaagatttagaatgtgcaaccaccaggctttcagaa
actagtcacatggatgtattctcccctgttgtgggcagtggaatagatgtgatgagtaga
agtaaagaggactgtgttccagtaccgccggaccactcacaagcttcttgcattgagcct
tccacacataaaactctgttatgggattcttttcagaggttgagtggtattggtatatta
catgaaactcttccagaagttggtcgcctaagtcttaatagttctactagttcagagact
agttttaatctggaaccaaagagttatgtgcacagtgatgcttttgcagatgatgtggga
aaaggacaagctattccagaattagattctaatttacaggctcgtctcactagttatgag
gctctgaagaaatctcttagcaaaatcagggaagaatcttacctgtctaatcccaagaca
cttgaacaacacaaagtagaactgagccctgtagccaaagctgtgcaagcagatgatgca
cacactgtttgggacactcaggatttgtttattgactacgcaaagccatcttccctcgtg
ccacttgatggaaaaacacagactgtatcactaactaaagcttttctggtggagcaaaaa
ttgaagaccacagtaccatgtagccttggagaatttctgcctagtttaaaagaagaagaa
atctcaagtaagagccttgaagcaagagactctctgatttga

DBGET integrated database retrieval system