KEGG   Mus musculus (mouse): 230514
Entry
230514            CDS       T01002                                 

Symbol
Leprot, LEPR, OB-, OB-RGRP, Ob, Obrgrp, VPS55
Name
(RefSeq) leptin receptor overlapping transcript
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Vps55 DUF4231 ECF-ribofla_trS SCAMP
Other DBs
NCBI-GeneID: 230514
NCBI-ProteinID: NP_778201
MGI: 2687005
Ensembl: ENSMUSG00000035212
Vega: OTTMUSG00000008452
UniProt: O89013
Position
4; 4 C6
AA seq 131 aa
MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSD
ATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVF
GRGDDFSWEQW
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcgggcgttaaagctctcgtggcgctctccttcagtggggcaattgggctgactttt
cttatgctgggatgtgcgttggaggactatggcgtttactggcccctgttcgtcttgatt
ttctacgtcatctcccccatcccctacttcattgccaaaagggtcacatatgactccgac
gcgaccagcagtgcctgtcgggaactggcgtatttcttcaccactgggattgttgtttct
gcctttggacttcctgttgttcttgctcgtgtggatgtgatcaagtggggagcctgtggt
cttgtgctggccggcaacgctgtcattttcctcacaattcaaggcttcttcctcgtcttt
ggaagaggagatgatttcagttgggaacagtggtag

DBGET integrated database retrieval system