KEGG   Mus musculus (mouse): 230584
Entry
230584            CDS       T01002                                 

Symbol
Yipf1, C030002N13Rik
Name
(RefSeq) Yip1 domain family, member 1
  KO
K22940  protein YIPF1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    230584 (Yipf1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   YIPF proteins
    230584 (Yipf1)
SSDB
Motif
Pfam: Yip1
Other DBs
NCBI-GeneID: 230584
NCBI-ProteinID: NP_663525
MGI: 1915532
Ensembl: ENSMUSG00000057375
Vega: OTTMUSG00000008802
UniProt: Q91VU1
Position
4; 4 C7
AA seq 306 aa
MAAVDDLQFEEFGDGATLLAANPDATTINIEDPSVSFGHQPRPPGSVGREEDEELLGNND
SDETELLAGQKRSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPVPGKNFVRLYIRSNPDL
YGPFWICATLVFAIAISGNLSNFLIHLGEKTYHYVPEFQKVSIAATVIYAYAWLVPLALW
GFLLWRNSKVMSMVSYSFLEIVCVYGYSLFIYIPTAVLWIIPQRVVRWVLVMIALGVSGS
VLVMTFWPAVREDNRRVALATIVTIVLLHVLLSVGCLAYFFDAPEMDHLPAAITTPNQTV
TAAKSS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcagctgtggatgacttacagtttgaagaatttggcgatggagctacactgttagca
gcaaatccagatgctaccacgataaacattgaggaccccagtgtatcttttggccaccaa
cccagaccccccgggagcgtggggcgagaagaggatgaggagctgctggggaacaacgac
tctgacgagaccgagttacttgccggtcagaagcgaagctctcccttctggacattcgaa
tactatcagacattctttgatgtggacacttaccaggtctttgacagaataaaagggtcc
ctgctgccggttcctggaaagaactttgtgaggctgtacatccgcagcaatccagatctc
tatggtcccttttggatatgtgccacgttggtctttgccatagcaattagtgggaacctt
tctaacttcctaatccatctgggagagaagacataccattatgtgcccgaattccagaaa
gtgtctatcgcagcgactgtcatctatgcctatgcctggctggtccctctggccctctgg
ggcttcctcctgtggagaaacagcaaagtgatgagcatggtttcctattcctttctggag
atcgtgtgtgtctacggctactcgctgttcatctatatccccacagcagtcctgtggatc
attccccagagggttgttcgttgggtccttgtcatgattgccctgggcgtctcaggctct
gtgttggtaatgacattttggccagctgttcgtgaggataaccggcgtgtcgccttggcc
accattgtgacaatcgtgttgcttcatgtgctgctctctgtgggctgcttggcttacttc
tttgatgctccagagatggaccacctcccagcagctataaccactcccaaccagacagta
acagcggccaaatccagctaa

DBGET integrated database retrieval system