KEGG   Mus musculus (house mouse): 230590
Entry
230590            CDS       T01002                                 
Symbol
Zyg11a
Name
(RefSeq) zyg-11 family member A, cell cycle regulator
  KO
K10350  Zyg-11 protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    230590 (Zyg11a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Target recognizing subunit
     230590 (Zyg11a)
SSDB
Motif
Pfam: ZER1-like_2nd LRR_4 Arm
Other DBs
NCBI-GeneID: 230590
NCBI-ProteinID: NP_001161408
MGI: 2446208
Ensembl: ENSMUSG00000034645
UniProt: A0A217FL76
Position
4:complement(108037442..108075285)
AA seq 708 aa
MVHFLHPLLWPRALVLPDAQQDAQGHCLVQEEASPYSLVNICLDVLIAELDKWCSKRPDG
TLCLPEHWYFPHEIADKFLERMAWQGKLTDRTASIFQGKQMSLKLINIPRVKLSAAAFTK
AFCHHKLIEVNATSVDSELLAPDIIHALQSSAWIQKNLQCLVLDSVSIPPNSGLVALSHF
TGLHTLSVANVSFCNEDLVSVSQLPNLGSLDISNTLVTNISALLSCKNRLRSLTMHYLKC
LAMNSPQVLAVIRQLKCLLHLDISDHQQLRSDLAFYLLQQKDILPNLTSLDISGGTDVTD
QAVESFLQHRPAMRFVGLLYTDAGYSDFFTAKQGLKVAGGANMSQISEALSRYRNRSCFV
KEALFRLFTETLSLRAVLPVMLKLVAIGMRNHPLDLPVQFTASACALNLTRQELARGMPV
RLLAEITDLLFKATKNFPYYQQLQKNCLLSLTSSRILMDVPFDRFDAAKLALRWVCRRES
PKLRTMAVSITSILALKLSPEEMGQLQEELIMAIKELLTIIRQKLAENLDDVTFLFTLKA
LWNLTDECPLACKYFMENEGLATVIRVLETFSISVIQSKVLGLLNNVAEVRELSSKLVTE
DVIERIISLLHSSNLEVSFLAAGVLAHLTCDRQHWLSRDLQRTDLLRYLHLAIQNWPSSR
CDMSVLVTYRSFKAFSPLLVNFSQPEVQRWALWAIHHVCSKNPRPKDV
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggtccatttcttgcatccgttgctgtggccgcgggccctcgtcctgcccgacgcccag
caggacgcgcagggccactgcttggtgcaggaggaggcatcaccctactcattggtcaac
atctgtctggatgtcttaattgctgaattggacaaatggtgttctaaaagacctgatgga
acattgtgtcttccagagcattggtattttcctcatgaaatagccgataaattccttgag
aggatggcttggcaaggcaagctgactgacagaacagcgagcattttccagggcaagcag
atgagcctgaagctcatcaatattccgagagttaaactctccgcagcagccttcacgaaa
gccttctgccatcacaagctcattgaagtgaatgccacgtcggtggactcggagcttctg
gccccagacatcatccacgctctccagagcagtgcctggatccagaagaacctccagtgt
cttgtgttagactcagtcagcatccctccgaactcaggactagtggccttgagtcatttc
actgggcttcacactttaagtgttgccaatgtgtccttttgcaatgaagacctagttagt
gtttctcagttaccgaacctgggaagcttggatatctccaatactctggtcaccaacatc
tctgcactcctctcctgtaagaaccgactcaggtctctcacaatgcactatctaaagtgc
ctggccatgaacagcccacaggtccttgcagttatcagacaactgaaatgcctgcttcac
cttgatatttctgatcatcagcagctcagatcagacctggctttttatctgttacagcag
aaggacatcctgcccaacctcacatccctggatatttcagggggcaccgacgtcactgat
caagctgtggaatcctttctgcagcaccggcctgccatgcgatttgtgggactcttgtat
acagatgctggctattctgatttctttacggcaaagcaaggcttgaaggttgctggagga
gccaacatgagtcagatttcagaagcactgagtcgttaccggaacaggtcgtgctttgtg
aaggaagctctcttcaggctcttcacggaaacactttccctgcgtgctgtcctgcctgtc
atgctaaagcttgtggctataggaatgaggaatcatccattggatctgccagtgcagttc
acagccagtgcttgcgctctcaacctaacacgccaggaactggccaggggaatgcctgtt
cgtctgttggcagagatcaccgatctacttttcaaagcaacgaaaaatttcccctactac
caacagttacagaagaattgcctcctctccttaaccagttccaggatccttatggatgtt
ccgtttgacaggttcgatgctgccaagctcgctctgaggtgggtgtgcaggcgtgagagc
cccaagctgcgaacaatggcagtgagcatcacctccatcctagccctgaagctctcacct
gaggagatgggacagcttcaggaggagctcattatggccatcaaggaacttctaacaatc
atcagacaaaagctggctgaaaatttagatgatgtcaccttcttgtttactctgaaagca
ctttggaatcttacggatgagtgtccattggcctgcaagtactttatggaaaacgaagga
ctagcaactgtcatccgagtcttagagacattttcaatatctgtgatacaaagcaaagta
cttggtcttttgaacaatgtcgctgaagtccgagagctctcttccaagctggtgacggaa
gatgtgatagaacgcatcatcagcttgctccacagcagcaacctggaagtgagcttcctg
gctgcgggtgtactagcccacctgacatgtgacaggcagcactggctatcccgggacctg
caaaggactgaccttctccgatacctgcacttagccatccagaattggccaagttcacgg
tgtgacatgtcagtattggtgacctacagatctttcaaagcattttccccactccttgtc
aacttctctcagccagaagttcagcgctgggcactgtgggccatacatcatgtttgcagt
aaaaacccgagacctaaagatgtctga

DBGET integrated database retrieval system