KEGG   Mus musculus (house mouse): 230594
Entry
230594            CDS       T01002                                 
Symbol
Tut4, 6030404K05Rik, 9230115F04Rik, PPAPD3, Tent3a, Zcchc11, mKIAA0191
Name
(RefSeq) terminal uridylyl transferase 4
  KO
K13291  terminal uridylyltransferase [EC:2.7.7.52]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    230594 (Tut4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.52  RNA uridylyltransferase
     230594 (Tut4)
SSDB
Motif
Pfam: TUTase PAP_assoc zf-CCHC NTP_transf_2 Polbeta zf-CCHC_4 zf-CCHC_2 PHD_4
Other DBs
NCBI-GeneID: 230594
NCBI-ProteinID: NP_780681
MGI: 2445126
Ensembl: ENSMUSG00000034610
UniProt: B2RX14 Q3V3D5 Q9EQN6
Position
4:108316607..108416612
AA seq 1644 aa
MEEPKTSKNENHEPKKNIICEESKAVKIISNQTLKPRNDKSEIGTSSLNRNSSKKTKQND
ICIEKTEAKSCKVNAASVPGPKDLGLVHRDQSHCKMKKLPNSPMKAQKGSSQTKLEKTPS
LQTKAEKVPKSPNLPVKAEKAPCTTAEATTEKALNSQRKEENTPTSQMKLQKTPRSPLEP
ENVPSLLLKENVKQTESQQTGKKLTSSFVSMDKRKSEALQGEKSALENSSLSQKQQTQTD
NIADSDDSASGIEDTADDLSKMKSEESNKENSSEMDYLENATVIDESALTPEQRLGLKQA
EERLERDHIFRLEKRSPEYTNCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESE
LRSLPSPSSAHLAALSVAVVELAKEQGITDDDLRIRQDIVEEMSKVIMTFLPECSLRLYG
SSLTKFALKSSDVNIDIKFPPKMNHPDLLIQVLGILKKSALYIDVESDFHAKVPVVVCKD
RKSALLCRVSAGNDMACLTTDLLAALGKVEPVFTPLVLAFRYWAKLCYIDSQTDGGIPSY
CFALMVMFFLQQRKPPLLPCLLGSWIEGFDPKRMDDFQLKGIVEEKFVKWEYNSSSATEK
NLIADENKAKADEPKDDTKKTETDNQSNAAKAKHGKSPLTLEAPNQVPLGQLWLELLKFY
TLDFALEEYVICVRIQDILTRENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEYVVERF
RAAYRYFACPQKKGGNKSTMDPKKKEKGKLSSKKPVKSDCSATNCCILGESAEKIHMERG
QPAKHDETEFTSQRCIVDNDSLLVNELGLANHGQDSSSLSTASGGSDLKQKSAEKQGDLT
PSETSLKKELSQCICIGTPDGAESAGTDCRSNLEMDSSHQIVCNNVSATSCNCKATEVTS
DLVDEDNLPSQELYYVFDKFILTSGKPPTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPM
TNRFREILDLVCKRCFDELSPPCSEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGF
GFRDSDLDICMTLEGHENAEKLNCKEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHR
RSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYA
YILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLGKNTE
SLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGV
SRKMTNFIMKAFINGRKLFGTPFYPLIGREAEYFFDSRVLTDGELAPNDRCCRVCGKIGH
YMKDCPKRKRLKKKDSEEEKEGNEEEKDSRDLLDSRDLRCFICGDAGHVRRECPEVKMAR
QRNSSVAAAQLVRNLVNAQQVAGSAQQQSDQSIRTRQSSECSDSPSYSPQPQPFPQNSPQ
PSALPPPPSQPGSQPKLGPPQQGGQPPHQVQMPLYNFPQSPPAHYSPMHSMGLLPMHPLQ
IPAPSWPIHGPMLHSAPGSTPSNIGLNDPSIIFAQPAARPMAIPSPSHDGHWPRTVAPNS
LVNNGAVGNSEPRFRGLNPPIPWEHAPRHFPLVPASWPYGLHQNFMHQGNPRFQPKPFYA
QADRCATRRCRERCPHPPRGNVSE
NT seq 4935 nt   +upstreamnt  +downstreamnt
atggaagagcccaagacttctaaaaacgaaaatcatgaaccaaagaagaatattatttgt
gaagaaagcaaagcagttaaaattatatctaatcaaaccttgaagcctagaaatgataag
tcagaaattgggaccagctctctgaatagaaatagtagtaaaaaaaccaagcaaaatgat
atttgtatagaaaaaacagaagctaaatcatgtaaagtaaacgctgccagtgttccaggc
cctaaagatttggggttagtacatcgagatcaaagtcattgcaaaatgaaaaagttacca
aattcacccatgaaagcccagaagggatcttcacagacaaaattagaaaagacacctagt
ttacagacaaaagcagaaaaagtaccaaagtctccaaatttaccagtaaaagcagaaaaa
gcgccctgtacaacagcagaagcaacaacagaaaaagcacttaattcacagagaaaagaa
gaaaacacacccacttctcagatgaaattacagaagacacccagatcacctttagagcca
gaaaatgtgcccagtttactattgaaagaaaatgtgaaacagacagaatcacaacagact
gggaagaaacttacaagctcctttgtttctatggataaaaggaagagtgaagctctacag
ggagaaaagtcagctctggaaaactcatcactatctcagaagcagcagactcagacagat
aatattgctgattctgatgacagtgcttcagggattgaagatacagcagatgatttgagt
aaaatgaagagtgaggaatctaacaaagaaaattcttctgagatggactatttagaaaat
gccactgtaatagatgaatctgctttgacacctgagcagaggctaggcttgaaacaagca
gaagaacgtctagaaagagatcacatcttccgacttgaaaaacggtcaccagaatatacc
aattgccgctatctatgcaaactttgcttaattcacattgaaaacatccaaggagcacat
aaacatataaaagaaaaacgacataagaaaaatattttggaaaaacaagaagagagtgaa
cttcggtctcttccatctccttcctctgctcacttggctgctttaagtgttgcagttgtt
gagttagcaaaagaacaaggaataacagatgatgacctcagaatccgccaggacattgtg
gaggaaatgtcaaaggttataatgacatttttaccagaatgttcactgaggttgtatggt
tcatctctgacaaagtttgctctgaaaagcagtgatgttaatatagatataaaatttcct
cccaagatgaatcatccagatcttctgatacaagtgcttggaattctgaaaaaaagtgca
ttatatatagatgtggaatctgattttcatgctaaagttcctgttgtggtgtgcaaagat
cggaaaagtgctttactgtgtagagtaagtgcaggaaatgatatggcgtgtctcacaact
gacttacttgctgctcttggcaaagtggaacccgtcttcactcccttagtgctagctttt
cgctattgggctaagctgtgctatattgactcccaaactgatggtggaatcccttcttac
tgctttgctttgatggtgatgttttttcttcaacaaagaaaaccccctcttcttccttgc
ttacttggaagttggattgaaggctttgacccgaaaagaatggatgactttcagctgaag
ggcatagtagaagagaagtttgtgaagtgggaatataattcaagtagtgcaactgagaaa
aacttaattgctgatgaaaacaaagctaaggcagacgaaccaaaagatgataccaagaag
acagaaacagacaaccaaagtaatgctgcgaaggcaaaacatggcaaatctcctttaaca
ttggaagcaccaaatcaggtacccttgggacagttgtggttggagctgctaaaattttac
acactggattttgctttggaggaatatgtcatatgtgtacggatacaagatattctaact
agagagaacaaaaactggcctaaaaggcggatagccattgaagatccattttcagtcaag
aggaatgttgcccggagcttaaacagccagcttgtatacgaatatgttgtggaaagattc
agagcagcttatcgatattttgcctgtcctcaaaagaagggtggaaataaatctacaatg
gatcctaagaagaaagagaaggggaagctaagcagtaagaaaccagtgaagtctgattgt
tcggcaaccaattgttgcattcttggggaaagtgcagaaaaaatacatatggaaagaggc
caacctgctaaacatgatgaaacggagtttacatcacagagatgtattgttgataatgac
agtttattggtaaatgaactaggtttggctaaccatggacaagattcttcatctctttct
actgccagtggaggcagtgacttaaagcaaaaatcagctgagaaacaaggtgatttaaca
ccttcagaaacttccttaaagaaggaactcagccagtgtatttgcattgggacccctgat
ggagctgaatctgctggaacagactgcagatcaaacttagaaatggacagttcacatcag
attgtgtgcaacaatgtatctgctacctcttgcaactgcaaagctacagaagttacttct
gaccttgttgatgaggataacctcccctcccaggaattatattatgtgtttgataagttc
attttaacctctggcaagccgccaacaatagtatgcagcatctgcaaaaaggatggccat
tcaaaaaatgattgtccagaggatttcaggaaaattgatctaaaacctctaccaccaatg
acaaaccgatttcgagaaatacttgatttagtatgtaaaagatgttttgatgaattatca
ccaccttgctctgaacaacacaacagggaacaaattttaattggcttggaaaagtttatt
caaaaagaatatgatgaaaaagcaagattgtgcttatttggttcttctaagaatggattt
ggattccgagatagtgatctggatatttgtatgactctggaaggccatgaaaatgcagag
aaattaaactgtaaagaaataattgaaaatttggcgaaaattcttaagaggcatccaggt
ttaagaaacattctgcctataactactgccaaagtgcctattgtaaaatttgaacacagg
agaagtggactagaaggtgatatcagtttatataacacattggctcaacacaacacaaga
atgctagctacttatgcagctattgatcctagagtacagtacttgggatatactatgaaa
gtgtttgcaaagcgctgtgacattggagatgcatctcggggaagtttatcttcatatgct
tacatccttatggtgctgtactttctgcagcaaagaaagccaccagttatcccagttcta
caagagatctttgatgggaagcagattccgcagagaatggttgatggatggaatgccttt
ttctttgataaaacagaagagctgaaaaagcgtttaccttcacttgggaagaacacggaa
tcactgggagagctttggttaggactgcttcgcttctatacagaagagtttgattttaag
gagtatgtaatcagtattcggcagaagaagctgctgaccacttttgaaaagcagtggact
tctaaatgcattgcaattgaagatccttttgacttgaatcataaccttggtgctggtgtt
tctagaaaaatgactaattttattatgaaggcgtttatcaatggaaggaaactttttggt
acccccttttatccactcattggcagagaagctgagtacttctttgattcaagagtacta
acagatggagagttggctcctaatgatcgttgttgccgtgtgtgtggaaaaataggtcac
tacatgaaagactgtcccaaaaggaaaagactaaagaagaaagacagtgaagaagagaag
gaagggaacgaagaagaaaaagactcccgtgaccttcttgactcccgagaccttaggtgt
ttcatatgtggagatgctggacatgttcgccgcgaatgcccagaggtcaagatggcccgc
cagaggaatagtagtgtggcagcagcccagctggtccgtaaccttgtaaatgctcagcag
gtggctggttcagcgcagcaacagagtgaccagtccataaggaccagacagtcttcagaa
tgttctgattcaccatcttattctcctcagcctcagccttttccacagaattctccccaa
ccatctgctcttcccccacctccatcccagccaggatcccagcctaagcttggcccaccc
cagcagggagggcagccccctcatcaggttcagatgcccttgtataactttcctcagtca
cctccagctcattattcacccatgcacagtatggggttactgccaatgcaccccctgcag
atccctgccccatcgtggcccatccacggcccgatgctgcactctgcacctggcagcacc
cccagcaacattggcttgaatgatcccagcatcatctttgcacagcctgctgccaggccc
atggcaattcccagcccttctcacgatggacactggcctcggaccgtggctcccaattcc
ctggtgaacaatggtgcagtgggtaattcggagccacgctttcgaggactaaatcctcca
attccatgggaacatgcaccacgccatttcccccttgtcccagcttcgtggccttacggt
ttgcatcaaaatttcatgcatcagggaaatccaagatttcagcccaaacccttctatgct
caagcagacagatgtgccacgcgtcgctgtagagagcgctgtccccacccaccacgagga
aacgtgtccgagtaa

DBGET integrated database retrieval system