KEGG   Mus musculus (mouse): 230598
Entry
230598            CDS       T01002                                 

Gene name
Nrd1, 2600011I06Rik, AI875733, NRD, NRD-C, Nrdc
Definition
(RefSeq) nardilysin, N-arginine dibasic convertase, NRD convertase 1
  KO
K01411  nardilysin [EC:3.4.24.61]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    230598 (Nrd1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.61  nardilysin
     230598 (Nrd1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   230598 (Nrd1)
SSDB
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C SDA1 Nop14 Mpp10
Other DBs
NCBI-GeneID: 230598
NCBI-ProteinID: NP_666262
MGI: 1201386
Ensembl: ENSMUSG00000053510
Vega: OTTMUSG00000008296
UniProt: Q8BHG1
Position
4; 4 C7
AA seq 1161 aa
MLRRVAVAAVCVTGRKLRCEAGRELTALGRIEARGLCEESSKPFPTLTMPGRNKAKSTCS
CPDLQPNGQDLGESGRLARLGADESEEEGRSFSNVGDPEIIKSPSDPKQYRYIKLQNGLQ
ALLISDLSNVEGKTGNATDEEEEEEEEEEEEDDDDDDDDDDDDEDSGAEIQDDDEEGFDD
EEEFDDDDDDEHDDDDLENEENELEELEERVEARKKTTEKQSAAALCVGVGSFADPDDLP
GLAHFLEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRKYFKEALDR
WAQFFIHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAE
TLKHEPKKNNIDTHARLREFWMRYYSAHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLP
KPNFSHLTDPFDTPAFNKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEG
KGSILSYLRKKCWALALFGGNGETGFEQNSTYSVFSISITLTDEGYEHFYEVAHTVFQYL
KMLQKLGPEKRVFEEIQKIEDNEFHYQEQTDPVEYVENMCENMQLYPRQDFLTGDQLLFE
YKPEVIAEALNQLVPQKANLVLLSGANEGRCDLKEKWFGTQYSIEDIENSWTELWKSNFD
LNPDLHLPAENKYIATDFTLKAFDCPETEYPAKIVNTAQGCLWYKKDNKFKIPKAYIRFH
LISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK
LPLLFQLIIDYLTEFSSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYSRWSMI
DKYQALMDGLSLDSLLNFVKDFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFAPLERE
MPVQFQVVELPSGHHLCKVRALNKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCF
DFLRTKQTLGYHVYPTCRNTSGILGFSVTVGTQATKYNSETVDKKIEEFLSSFEEKIENL
TEDAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFSKSDLV
SWFKAHRGPGSKMLSVHVVGYGKYELEEDGAPFGEDSNSREGMQLTYLPPSPVLAESTTP
ITDIRAFTATLSLFPYHKIVK
NT seq 3486 nt   +upstreamnt  +downstreamnt
atgctgaggagagtcgcggttgctgcagtctgtgtcaccgggaggaagttgcggtgtgag
gccgggcgggagctcacggctctggggcgaatcgaagcacggggtctgtgcgaagaatca
tcgaaaccctttcctacgctgaccatgcctggaagaaacaaggcgaagtccacctgcagt
tgcccggacctgcagcccaatggacaggacttgggcgagagcggccggcttgctcgtcta
ggagcggatgaatctgaggaggagggacggtctttcagtaatgtcggggaccctgagatc
atcaagtctcccagcgatcccaagcagtaccgatacatcaaattacagaatggcttgcag
gcacttttgatttcagatctaagtaatgtggaaggtaagacaggaaatgcaacagatgaa
gaggaggaagaagaggaggaggaagaggaagaagatgatgatgatgacgacgacgacgac
gatgatgatgaagactctggagctgagatacaagatgatgatgaggaaggttttgatgat
gaagaggaatttgatgatgacgatgatgatgaacatgatgatgatgatcttgagaatgag
gaaaacgaactggaagagttggaagagagggtagaagccaggaagaaaactactgagaaa
cagtctgcagcggctctgtgtgttggagttgggagctttgctgatccagatgacctgcct
gggctggcacactttttggagcacatggtattcatgggtagtttgaaataccctgatgag
aatggatttgatgccttcctcaagaaacatggaggtagtgataatgcctcaactgattgt
gaacgcacagtctttcagtttgatgtccagagaaagtatttcaaggaagccctggataga
tgggcccagttctttatccatccactgatgatcagagatgcaattgaccgagaggtggaa
gctgtggacagtgagtatcagcttgcaaggccttctgatgcaaacagaaaagaaatgttg
tttggaagcctcgctagaccgggacatcctatggggaagtttttttggggaaatgctgag
acactcaagcatgaaccaaagaagaataacattgatacacatgccagactgagagaattc
tggatgcgctactactctgctcattacatgaccttagttgttcagtccaaagaaaccctg
gacactttggaaaagtgggtgacggagatcttctctcagataccaaacaatgggctacct
aaaccaaactttagccatttaacggatccttttgacacaccagcatttaacaaactttat
agagttgttccaatcagaaaaatccatgctctgaccatcacatgggcacttcctcctcag
cagcagcactacagggtgaagccacttcattatatttcctggcttgttggacatgaaggc
aaaggcagcattctttcttatcttagaaaaaagtgctgggctcttgcattgtttggtgga
aatggtgagacaggttttgagcaaaattctacttactcagtgttcagcatttctattacg
ctgactgatgagggctatgagcatttttatgaggttgcccacactgtctttcagtattta
aaaatgctgcagaagctaggtccagagaaaagagtttttgaagagattcagaaaattgag
gataatgaatttcattatcaagaacagacagatccagtcgagtatgtggagaacatgtgt
gagaacatgcagctgtacccacgtcaggactttctcaccggagatcagcttctgtttgag
tacaagccagaagtcattgctgaggcccttaatcagctagttcctcagaaggcaaatctc
gttcttctctctggtgctaatgagggaagatgtgacctcaaggagaagtggtttgggact
cagtatagcatagaagatattgaaaactcttggactgaactatggaagagtaattttgac
ttaaatccagaccttcatcttccagctgaaaataagtacatagccacggactttacgttg
aaggcttttgattgccctgaaactgaataccctgctaaaattgtcaataccgcacaaggc
tgcttgtggtataagaaagacaacaaattcaaaatccccaaagcatatatacgatttcat
ctgatctcacctttgatacagaaatctgcagcaaatgttgtcctctttgacatcttcgtg
aatattcttacgcacaaccttgccgaacccgcctatgaagctgatgtggcacagctggag
tataaactggtagctggagaacatgggttaattattcgagtgaaaggattcaaccacaaa
ctacctctgctctttcagctcattattgactacctgactgagttcagttccacacccgct
gtctttaccatgataactgagcaactgaagaagacctacttcaacatcctcatcaagccc
gagactctggccaaagatgtgcggcttttaattctggaatattcccgctggtctatgatt
gacaagtaccaagctttgatggatggcctttcccttgattctctgctaaactttgtcaag
gattttaaatcccaactttttgttgagggcctggtccaagggaatgtcaccagcacggaa
tcgatggatttcctaaaatatgttgttgacaagctgaacttcgcgcccctggagcgggag
atgcctgtgcagttccaggtggtggagctgccgagcggccaccacctgtgcaaagtcaga
gctctgaataaaggggatgccaactctgaagtcactgtgtactaccagtcaggtacgagg
agtctgagagaatatactcttatggagctgcttgtgatgcacatggaagagccctgcttt
gacttccttcgcaccaagcagacccttgggtaccatgtctacccaacctgtaggaacaca
tctggaattctaggattttctgtaactgttgggactcaggcaaccaaatacaactccgaa
actgttgacaagaagatagaggaatttctttccagctttgaggagaagattgagaacctc
acagaagatgcattcaatactcaggtcacagcactgatcaagttgaaagagtgtgaggac
acccaccttggggaggaggtggacaggaactggaatgaagtggtgacacagcagtatctc
tttgaccgccttgcccatgagattgaagccctgaagtctttctcaaagtcagacctggtc
agctggttcaaggctcacagaggacctggaagtaaaatgctcagcgttcatgttgttgga
tatgggaagtatgaactggaagaggatggtgccccttttggtgaggattcaaattctcgt
gaagggatgcagctaacctacctgccaccctctcctgtcctggcagaatccaccaccccc
attactgacatcagggccttcacagcaacactcagcctcttcccctaccataaaatagtc
aaataa

DBGET integrated database retrieval system