KEGG   Mus musculus (mouse): 230613
Entry
230613            CDS       T01002                                 

Symbol
Skint10, A030001H23Rik, Gm570
Name
(RefSeq) selection and upkeep of intraepithelial T cells 10
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 230613
NCBI-ProteinID: NP_808336
MGI: 2685416
Ensembl: ENSMUSG00000048766
Vega: OTTMUSG00000008539
UniProt: A7TZG1 Q8CA07
Position
4; 4 D1
AA seq 354 aa
MFLRTQMEQSQADIFALIKPHFGVMESSASYLPGFFMTFLLLQTTVLTQAMSLDIQINIQ
VPDTEGVLLECTSGSLIPPAEMTWRDSKGNIIPHSTTFDSQDRAGLLYLKSSILLKNRVQ
SPITCSIYNVTTNREKKRSVVLPDILFKSEYMSLMSNKFSCPLTYLFIIIFLNCLKGMLD
FCCLKGKPVYFRELINKIKEVLNIKMRACCTLIWEFLLIVLYIAFLPFYLKFRSRASILD
DAYPLHSNWLWDICIVLSVLMIFFTGLSLFLLWTLNCYGQMSYLPSMSMDLSKHDFEQNS
SKSSEFQENYDVSCEIFLGTFEETIFSQHQESCIEDSFNPLQPLRLDCSLNWKT
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtttctgaggacacagatggagcaaagtcaagctgacatttttgcattgattaaacca
cattttggtgtgatggagtcttcagcttcctatttacctggattctttatgaccttcctt
ctcttacagaccacagtactcacccaagctatgagcttggatatacagattaacattcag
gttccagatacagaaggggtactcttggagtgtacttcaggaagcttgatcccacctgct
gagatgacatggagagacagcaaagggaatataattccacattcaaccacatttgactct
caggatagagctgggttattgtatttgaaaagcagcattcttctgaagaacagagttcaa
agtcctattacttgctccatttacaatgtaacaactaatcgggagaaaaaaagaagcgtt
gtcctaccagatatcctattcaaatcggaatatatgtcattgatgtcaaacaaattttca
tgtcctttaacatatttattcattataatttttcttaattgtctcaaaggaatgcttgat
ttctgttgtctcaaaggaaaacctgtttatttcagagaactaatcaataaaatcaaggaa
gttttgaatattaaaatgagagcttgctgtacacttatctgggagtttctactgatagtt
ttgtatattgcgttcctccctttctacttgaaattcagaagcagagcttctattttggat
gatgcatacccattacatagtaattggctgtgggacatatgcatagtcttgagtgtgctg
atgatatttttcactgggctcagtttgtttctactttggaccctaaactgttatggtcag
atgtcatacttaccttccatgagcatggatctttccaaacatgactttgagcaaaatagt
tctaaatcttctgagttccaagaaaattatgatgtgagctgcgaaatattcctaggaact
tttgaagaaacaatatttagtcaacaccaagaaagttgtatagaggatagcttcaaccca
cttcagcccttaagattggattgcagtcttaattggaaaacttga

DBGET integrated database retrieval system