KEGG   Mus musculus (mouse): 230648
Entry
230648            CDS       T01002                                 

Symbol
Efcab14, 4732418C07Rik
Name
(RefSeq) EF-hand calcium binding domain 14
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Fib_alpha EF-hand_5 BpuJI_N NPV_P10 BLOC1_2
Other DBs
NCBI-GeneID: 230648
NCBI-ProteinID: NP_001355556
MGI: 2442397
Ensembl: ENSMUSG00000034210
Vega: OTTMUSG00000008688
Position
4:115594914..115634590
AA seq 484 aa
MKKRKELNALIGLAGDHRRKKTKQGSGSHRLLRTEPPDSDSESSTDEEEFGAIGNRSRFV
KGDYARCCKICCPLCAFVILAACVVASVGLVWMQMALKEDLDVLKEKFRTMESNQKSSFQ
EIPKLNEELLSKQKQLEKIESGELGLSRVWINITEMNKQISLLSSAVNHLKASVKSAADL
LSLPSTVEGLQKSVASIGNTLNSVHLAVEVIQKTVDEHRTTLGLLQGSMENNGSNQILPS
PSPPSELDNKSHSESAKQDILYLHNSLEEVNSTVVEYQRQNDLKLKGMSETLSNLTQRLS
LIESHVVALSKAEQRTNVSSSTMENRAATLKRESLVTNRSDTVQAQSMKKEDNSNSQVSE
LREKLQLISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPLSLP
GISSIKDLQDLFHKTGQDVDGMLTYQELWNSLGSAMPRPESLRAFDSNGDGRYSFLELRL
ALGI
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaaaaagcgcaaagagctcaatgcgttgatcggcctggctggtgaccatcggagaaag
aagaccaagcaaggctcaggcagccaccgcctgcttcgcactgagcctcctgactcagac
tcagagtccagcacagacgaagaggaatttggagcaattggaaatcgctctcgttttgtc
aagggagactatgcccgatgctgcaagatctgctgtcccctctgtgcctttgtcatcctc
gcagcctgcgttgtggcctctgtgggcttggtgtggatgcaaatggctctcaaggaggat
ctggatgtcctcaaggaaaaatttagaacaatggagtctaatcagaagagctcattccag
gaaatccccaaacttaatgaggaacttctcagcaaacaaaaacaacttgagaagattgag
tctggggagctgggcttaagcagagtctggatcaacatcacagaaatgaataagcagatt
tctctcttgagttctgcagtaaaccacctaaaagccagcgtcaagtcagccgcagactta
cttagtctgcctagcactgtagaaggacttcagaagagtgtggcttccattggcaatact
ttaaacagtgtccaccttgctgtagaggtgatacagaagactgtggatgagcacaggaca
accttggggttactgcagggcagtatggagaacaatggaagcaaccagatcttgccatca
ccttcacctccatcagagcttgacaataaatcccacagtgaaagtgcaaaacaggatatc
ctgtacctgcacaactccttagaggaagtcaacagtactgtagtggaataccagagacag
aatgaccttaaactcaagggaatgagcgagaccctcagtaacctgacacagagactcagc
ctgatagaaagccatgtggttgcactgagcaaggcagaacagagaacaaacgtgagctcc
agcacgatggagaatagggctgccactctgaaaagagagtctttggtgaccaacagaagt
gacactgtacaggcgcaaagcatgaagaaagaagataattcaaattctcaggtatccgag
cttcgagaaaaactgcagctgatcagtgctctcacaaacaaacctgaaagcaacaggcct
ccggagaccacagatgaagagcaagtacagaacttcacatcagatccttcagcattgcca
gaattttcacagcttcttagaaaccaaattgagacccaagtaaaacctctctccctgcct
gggatttctagcatcaaagatcttcaggatttattccacaagactggtcaagatgtggat
gggatgctgacctaccaggaactctggaactccctaggttctgccatgccaagaccagag
agcttgagagcatttgattcgaatggagatggaagatactctttcctggaactaagatta
gctttaggtatctag

DBGET integrated database retrieval system