KEGG   Mus musculus (mouse): 230673
Entry
230673            CDS       T01002                                 

Symbol
Ipo13, Imp13, Kap13, Ranbp13
Name
(RefSeq) importin 13
  KO
K25202  importin-13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    230673 (Ipo13)
SSDB
Motif
Pfam: Importin_rep_2 Xpo1 Importin_rep_3 Importin_rep IBN_N
Other DBs
NCBI-GeneID: 230673
NCBI-ProteinID: NP_666264
MGI: 2385205
Ensembl: ENSMUSG00000033365
Vega: OTTMUSG00000008657
UniProt: Q8K0C1
Position
4; 4 D1
AA seq 963 aa
MERREEQLGAAGAGAAPALDFTVENVEKALHQLYYDPNIDNKNLAQKWLMQAQVSPQAWH
FSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVL
TRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDSQGRCLALLELLTVLPEEFQTS
RLPQYRKGLVRTSLAVECGTVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCE
ALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNG
DMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLT
LTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQF
RIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETI
DVNYSDVVPGLIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGN
PELSVSSVSTLKKICRECKYDLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSA
LQVEEILKNLHSLISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTTLDVSHHEDDH
EGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVEAVCAIFEKSVKTLLDDF
APMVPQLCEMLGRMYSTVPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLSLFQ
QGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGF
FTELLPRCGEIESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLL
SMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYT
ADY
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggagcggcgggaggagcagctgggggctgcaggggctggagcagcaccagccttggac
ttcactgtggagaacgtggagaaggcgctgcaccagctctactacgaccccaatattgac
aacaagaacctggctcagaagtggctgatgcaggcccaggtctctccacaggcctggcac
ttcagctggcagctactacagccagacaaggtgcccgagatccagtactttggggccagt
gccctgcacatcaagatctctcgctactggagcgacatccccaccgaccagtatgaaagc
ttaaaggcacagctcttcacccagatcacccgctttgccagcggctccaaaattgtgctg
actcggctgtgcgtggcgctggcctcactagctctcagcatgatgcctgacgcttggcca
tgtgctgtggcagatatggttcggctcttccaggctgaggactcgccggtggatagccag
ggccgttgcctggccctgctagagttgctgacagtactgcccgaggagtttcagaccagc
cgcttgccccagtaccgcaaaggtctggtgcggaccagcctggctgtggagtgtgggact
gtcttcccattgctggagcaactgctacaacagcccagctctcctagctgtgtgcgtcag
aaggtgctcaagtgcttctccagttgggtgcagctggaggtacccctgcaggactgtgag
gcgctcattcaggctgccttcgccgctctgcaggactcagagctctttgacagcagcgtg
gaggccattgtcaatgccatctcccaacctgatgcccaaaggtacgtgaacacactcctg
aaactcattcctctggtgctgggactgcaggaacaactgcggcaggcagtgcagaatggg
gacatggagacctcccatggcatctgccgtattgctgtggccctgggcgagaaccactct
cgggccttgctagaccaagtagagcactggcagagcttcctggcactcgtcaacatgatc
atgttctgcactggcatccctggccactatcctgtcaacgagaccaccagctccctcact
ctcactttctggtacacactgcaggatgacattctgtcctttgaggcagagaagcaggct
gtgtaccagcaggtgtaccggccagtctacttccagctggtggacgtgcttctgcacaag
gcccagttcccttctgacgaggagtatggattctggtcctcagacgaaaaggagcagttc
cgtatctacagggtggacatctcagacacactcatgtatgtctatgagatgctgggggct
gagctgcttagcaacctctatgacaagctgggccgtttgctcaccagctcagaggagccc
tactcctggcagcacacagaagccctgctctatggcttccagtccattgcagagaccatc
gatgtcaactactctgatgtggtaccagggctcattggcctcatcccacggatcagcatc
agcaacgtgcagttggcggatactgtcatgttcaccattggagctctgtctgaatggctg
gctgaccaccccgtcatgatcaacagcgttctgccccttgtgctgcatgccctaggcaat
cctgagctgtctgtgtcatctgtgtcgaccctcaaaaagatctgccgagagtgcaagtat
gacctgccgccctatgctgccaacattgtagctgtctcccaggatgtgctgatgaagcag
attcacaagacaagccagtgcatgtggctgatgcaggccctgggcttcctgctgtcagcc
ctgcaggtggaggagatcctgaagaacctgcactccctcatctctccctacatccaacag
ctggagaagctggcagaagagatacctaatccctctaacaagctggccattgtccacatc
ttggggcttctttccaacctctttaccacactggacgtcagtcatcatgaggatgatcat
gaaggccctgaactccggaagttgccagtgccacaaggacccaacccggtggtggttgtg
ctgcagcaggtcttccagctcatccagaaggtgctgagcaagtggctgaatgacgcccag
gtggttgaggcggtatgcgccatctttgagaagtctgttaagacactgctggatgacttt
gcccccatggtgccgcagctctgtgagatgctgggtcggatgtacagtactgttccccag
gcctctgctcttgacctcacccggcagctggtccacatctttgcccacgagcctgcccac
tttcccccaatagaggccctcttcctgctggtgacttccgtcacactcagtctcttccag
caagggcccagggatcatcctgatattgttgattcatttatgcaactcctggcacaggct
ttgaagcggaagccagatttgttcctgtgtgagcgactggatgtcaaagctgtgttccag
tgtgccgtgctggccctcaagttccctgaggcacctactgtcaaggcctcctgtggcttc
tttactgagctgctgcctcgatgtggggaaatagagtctgtggggaaagtggtacaggaa
gatggccgtatgctgctcatagcagtgctggaggccatcgggggccaggcctcccgtagc
ctcatggactgttttgccgacatcctgttcgccctgaacaaacactgcttcagcctcctg
agcatgtggatcaaggaggctctgcagccacctggttttccatctgcccgtctcagccct
gagcagaaggacacctttagccagcagatacttcgtgagcgagtaaacaagagacgggtg
aaggagatggtgaaggaatttacactgctctgccgggggctacatggcacggactacaca
gctgactactga

DBGET integrated database retrieval system