KEGG   Mus musculus (house mouse): 230674
Entry
230674            CDS       T01002                                 
Symbol
Kdm4a, D4Ertd222e, JHDM3A, Jmjd2, Jmjd2a, mKIAA0677
Name
(RefSeq) lysine (K)-specific demethylase 4A
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    230674 (Kdm4a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     230674 (Kdm4a)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     230674 (Kdm4a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    230674 (Kdm4a)
SSDB
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 PHD_2 zf-HC5HC2H JmjN PHD 53-BP1_Tudor Tudor_5 LBR_tudor Rad9_Rad53_bind DUF4537
Other DBs
NCBI-GeneID: 230674
NCBI-ProteinID: NP_001155295
MGI: 2446210
Ensembl: ENSMUSG00000033326
UniProt: Q8BW72
Position
4:complement(117994154..118037242)
AA seq 1064 aa
MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRTSYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEQHVDEWNIGRLKTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRRFQPERYKLWKAGKDSMVIDHTLPTPEAAEFLKDSGGL
TPRAGSEECPEEDVEAADQGEEGDVKRSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEEL
SSGQYEMTECPATLAPVRPTHSSVRQVEDSLPFPDYSDPTEVKFEELKNVKLEEEDEEDE
PEAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSTSSQDSVSSDSETAESVSCQGQEKTG
VLTVHSYARGDGKAATGEPSVKKKRSAPRSISEQELAEVADEYMLSLEENKKTKGRRQPL
SKLPRHHPLVLQECGSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNEI
MAQQAPHCAVCMIFQTYHQVEFGAFSQSCGDASEPAAQTQRTKPLIPEMCFTTTGCSTDI
NLSTPYLEEDGTSMLVSCKKCSVRVHASCYGVPPAKASEEWMCSRCSANALEEDCCLCSL
RGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCVFCKKRRKRN
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALLSIT
AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQLGPPAEG
EVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSV
ASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
NT seq 3195 nt   +upstreamnt  +downstreamnt
atggcttctgaatcagaaactttgaaccccagtgctcggatcatgaccttttaccccacc
atggaagagttccggaacttcagccgctacattgcctacattgaatcccaaggagctcat
cgggctgggctagccaaggtcgttcctcccaaagagtggaagcctcgaacatcctacgac
gatattgatgatctagtcatccctgcgcccatccagcagctggtgactggccagtctggc
ctcttcactcagtacaacatacagaagaaagccatgaccgttcgtgagttccgcaagatc
gccaatagcgacaagtactgcaccccgcgatacagtgaatttgaagaacttgagcgtaaa
tactggaaaaacctcacattcaatcctcccatctatggagcagacgtgaatggtactctc
tatgaacagcacgttgatgagtggaatatcggccggctgaagaccatcctggacctggtg
gagaaggagagcgggatcaccattgagggggtgaacaccccctacctttacttcggcatg
tggaagacgtccttcgcctggcacacggaagacatggatctatacagcatcaactatctg
cacttcggagagccaaagtcttggtactctgttccacctgagcatgggaaacgcctggag
cgtcttgccaaaggctttttcccaggaagtgctcaaagctgtgaggcttttctccgccac
aagatgaccctgatctccccattaatgctgaagaagtatggcattccctttgacaaggtg
acccaagaagctggcgagtttatgatcacttttccgtatggttaccatgctggcttcaac
catggcttcaactgtgcagagtcaaccaattttgctacccgtcggtggattgagtatggc
aagcaggctgtgctgtgctcctgcagaaaagatatggtgaagatctccatggacgtgttc
gtgaggaggttccagccggaacgctacaaactttggaaagctgggaaggacagcatggtt
attgaccacactctgcccacaccggaagcagccgagttcctgaaggacagcggcggacta
accccgagagcagggagtgaggagtgcccagaggaggacgtggaagcagcggatcaggga
gaggagggggatgtgaagagaagcctggccaagcatcggatcgggacaaagagacacaga
gtctgtctggaaataccccaggaggtcagtcagagcgagctcttccccaaggaagagcta
agttctggacagtatgagatgacagagtgcccggccaccctcgccccagtgaggcccacc
cacagctccgtgcggcaagttgaggacagtcttcccttcccagattactctgaccccact
gaagtcaaatttgaagagctgaagaatgtcaaactagaagaggaagatgaggaggatgag
cccgaagcagccgcactggacctttctgtgaatcctgcgtctgtaggaggacgcctcgtc
ttctcgggttccaaaaagaaatcatcttccagcctgggctccacttcatctcaggattca
gtttcttcagattctgaaaccgccgagtctgtctcttgccagggccaagagaaaacggga
gttctcaccgtgcacagctatgccagaggggacggcaaggctgccacaggagagccgagt
gtgaagaagaagcgcagtgctccccgcagcatcagcgagcaggagctggcagaggttgca
gatgagtacatgctttccctggaggagaataagaagaccaagggtcgccgccagcccttg
agcaagctcccacgccaccacccactcgtgctgcaggagtgcggcagcgatgacgagact
tctgagcagctgacccccgaggaggaggctgaggagacagaggcttgggccaagcctctg
agccagctgtggcagaaccgacccccgaactttgaggctgaaaaggaattcaatgagatc
atggcccaacaggcccctcactgtgctgtgtgtatgatcttccagacctaccatcaggtg
gaatttggagccttcagtcagagctgtggggatgcttcagagccggctgcccagactcag
aggaccaagccactgatccccgaaatgtgctttaccaccactggctgcagcacagacatc
aatctgtccaccccgtacctagaggaggatggcaccagcatgctagtgtcctgcaagaag
tgcagtgtccgggtccacgccagttgctatggcgtccctcctgccaaggcttctgaagaa
tggatgtgctctcgatgttcagccaatgccctggaggaagactgctgcttatgctcgttg
cgtggaggggccctgcagagagccaatgacgacagatgggttcatgtttcatgtgcagtg
gcaattctagaagcaaggtttgtcaacattgctgaaagaagtccagtggatgtgagcaaa
atccctctgccccgcttcaaactgaagtgtgttttttgtaagaagcggagaaaacggaat
gctggctgctgtgtgcagtgctcccatggccgctgccccactgccttccatgtgagctgt
gcccaggctgctggggtgatgatgcaacccgacgactggccctttgttgtcttcatcacg
tgcttccgtcacaagattcccaatctggagcgtgctaagggagccttgctgagcatcacg
gcgggccagaaggttatcagcaaacacaagaacgggcgcttctaccagtgtgaggtggtc
agactcaccaccgagaccttctacgaagtcaactttgacgacggctccttcagtgacaac
ctttatcctgaggacatagtgagtcaggactgtctccaactggggcctcctgctgaaggt
gaagtggttcaagtcagatggacagatggccaagtctatggggctaagtttgtggcctcc
caccccatccagatgtaccaggtggagtttgaggatggctcgcagctggtggttaagaga
gatgatgtatacacactcgatgaagagcttcccaagagagtcaagtctagactgtcggtg
gcttcagacatgcgcttcaatgagattttcacagagaaggaagtgaagcaagaaaagaag
aggcaacgggtcatcaactcgcggtaccgggaggattacatcgagccagcgctgtaccgg
gccatcatggagtag

DBGET integrated database retrieval system