KEGG   Mus musculus (house mouse): 230709
Entry
230709            CDS       T01002                                 
Symbol
Zmpste24, A530043O15Rik, D030046F19, FACE1, Face-1, MADB, STE24, Ste24p
Name
(RefSeq) zinc metallopeptidase, STE24
  KO
K06013  STE24 endopeptidase [EC:3.4.24.84]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    230709 (Zmpste24)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    230709 (Zmpste24)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    230709 (Zmpste24)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.84  Ste24 endopeptidase
     230709 (Zmpste24)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   230709 (Zmpste24)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   230709 (Zmpste24)
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M48_N
Other DBs
NCBI-GeneID: 230709
NCBI-ProteinID: NP_766288
MGI: 1890508
Ensembl: ENSMUSG00000043207
UniProt: Q80W54 B9EHY2
Position
4:complement(120916434..120955452)
AA seq 475 aa
MGMWASVDAMWDFPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTRVPAELEQIMD
SDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPYLWRLSGQFCSSAGFGPEYEI
IQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAIKKFIVTQCILLP
VSALLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEV
MAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEESGM
EARNEGEGDSEEVKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCF
FLFAVLIGRRELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADA
FAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSTWHYSHPPLLERLQALKNAKQD
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggggatgtgggcatcggtggacgctatgtgggacttccctgcggagaagcgaatcttc
ggggcggtgttgctcttttcctggacggtgtatctttgggagaccttcctagcacagcgg
cagagaaggatatacaaaacgacgactcgcgtaccagcagagttagaacagatcatggat
tcggacacgtttgagaaatctcgattgtatcaactggataaaagtaccttcagcttctgg
tcaggactctactcagaggtggaaggcacttttattcttctctttggaggaatcccttac
ctctggagactttctgggcagttctgtagttctgctggctttggaccagaatacgagatc
attcagtcattggtgttcctgctgttggccacactcttcagtgcactgactggcttgccc
tggagtctgtacaatacttttgtaatagaagaaaagcatggcttcaatcaccagactttg
gagttttttatgaaagatgcaatcaaaaaatttattgtgactcaatgtattttattgcct
gtgtctgcccttctgctttacattattaaaattggaggtgactacttttttatatatgcc
tggctgttcacattagttgtttctctggttcttgtcaccatttatgctgactatattgcc
cctctgtttgacaaattcacacctctaccggagggaaagcttaagcaggaaattgaagtg
atggcaaagagtattgacttccctttgactaaggtgtatgttgttgaaggatctaagcgt
tcctcccacagcaatgcttacttttatggcttcttcaagaacaagagaatagttttgttt
gacactctactagaagagtactctgtaccaaacaaagacaaccaggaggagtctggcatg
gaagcccgcaatgaaggtgaaggggacagtgaagaagtaaaagctaaagtgaaaaataag
aaacaaggttgtaaaaatgaggaggtactggctgtgcttggccatgaactgggacactgg
aagttgggacacacagtaaaaaatatcattattagtcagatgaattctttcctgtgtttt
ttcttgtttgctgtattaattggtcgaagggaactttttgccgcctttggtttttatgac
agccaacccactctgatcggactcttgatcatctttcagtttattttctcaccttacaat
gaggttctgtctttctgcctaacagtcctgagccgcagatttgaatttcaagctgatgcg
tttgccaagaaacttgggaaggctaaagacttatattctgctttgatcaagctgaacaaa
gataacctgggattcccggtttctgactggttgttttcaacatggcactattcacaccct
ccgcttctagagaggcttcaggctctgaaaaatgcaaaacaagactga

DBGET integrated database retrieval system