KEGG   Mus musculus (mouse): 230737
Entry
230737            CDS       T01002                                 

Gene name
Gnl2, BC003262, HUMAUANTIG, Ngp-1
Definition
(RefSeq) guanine nucleotide binding protein-like 2 (nucleolar)
  KO
K14537  nuclear GTP-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    230737 (Gnl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    230737 (Gnl2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   GTPases
    230737 (Gnl2)
SSDB
Motif
Pfam: NGP1NT MMR_HSR1 FeoB_N RsgA_GTPase Arf
Other DBs
NCBI-GeneID: 230737
NCBI-ProteinID: NP_663527
MGI: 2385207
Ensembl: ENSMUSG00000028869
Vega: OTTMUSG00000009250
UniProt: Q99LH1 Q3V3N5
Position
4; 4 D2.2
AA seq 728 aa
MVKPKYKGRSTINRSAASTNPDRVQGAGGQNMRDRGTIRRLNMYRQKERRNSRGKVIKPL
QYQSTVASGTVARVEPNIKWFGNTRVIKQASLQKFQEEMDKVMKDPYKVVMKQSKLPMSL
LHDRIQPHNAKVHILDTESFESTFGPKSQRKRPNLFASDMQSLLENAEMSTESYDQGKDR
DLVMEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIEAY
LKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHASLTNPFGKGAFIQLLRQ
FGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLI
DCPGVVYPSEDSETDIVLKGVVQVEKIKAPQDHIGAVLERAKPEYISKTYKIESWENAED
FLEKLALRTGKLLKGGEPDMLTVSKMVLNDWQRGRIPFFVKPPNAELPTDSQLPPSSPLE
VPTETTQNNPEEETTETEVERSDSITEKEPEGDCSQDRNSEMQQILARVRQNFGKINVGP
QFSADDLVPVEMSDLEDLESSGEEEEQEQEQPGEDAEEERSPDTQEEPVGNDTKAVLRAL
DEKIAKYQRFLNKAKAKKFSAVRISKDLSEKVFAKYKEEKKTSAEDSDAAPTKKARKWDA
QMEEEPSNKTQRMLTCKERRRAARQQQSKKVGVRYYETHNVKNRNRNKKKTSDSEGQKHR
RNKFRQKQ
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggtgaagcccaagtacaaaggacggagcaccatcaaccgctcggcggccagcaccaac
ccagatcgagtacagggagctggcggccaaaacatgagggatcggggcacaattcggcgc
ctgaatatgtacaggcaaaaggagcgcaggaacagtcgtggtaaagtgattaagccactg
cagtatcagtcaactgtggcttctggcacagtggcccgagtggagccgaatattaaatgg
tttggaaatactcgtgtgatcaagcaggcatcattacaaaaatttcaagaggaaatggat
aaagttatgaaggatccatacaaagttgtcatgaaacaaagcaaattaccgatgtctctt
ctgcacgatcgaatccagcctcataacgcaaaagtccacattcttgatactgaaagcttt
gaaagtacatttggcccaaagtcacagagaaagcggccaaacttgtttgcaagtgatatg
caatcccttctagaaaacgctgaaatgtctactgagagctatgaccagggcaaggaccgt
gatttggtgatggaggacactggtgtaagaaatgaagctcaagaagagatatataaaaaa
gggcagtcaaaaagaatatggggagaactctacaaggtgatagactcatcagatgttgtc
gttcaagtccttgacgctagagatccgatgggcactcgttccccccacatcgaagcttac
ttgaaaaaggaaaaaccctggaaacatctcatttttgtactcaataagtgtgaccttgtt
ccaacttgggcaaccaaacgatgggttgctgtgctctcccaggactacccaacactggct
ttccatgcgagcctcaccaatccctttgggaagggagcattcattcagcttctgcggcag
tttgggaagttgcacacagacaagaaacaaatcagtgttgggttcattggctatccaaat
gtaggcaagagctctgtgattaatacattacgatccaagaaagtttgcaacgtggccccc
attgctggagaaacaaaggtctggcagtatattaccttgatgcgtcgtatattcctgatt
gactgccctggtgtggtttacccatctgaggactcagagaccgacattgtgctcaaagga
gtggttcaagttgagaaaattaaagctcctcaagaccacattggtgctgtccttgaacga
gcaaagccagagtatatcagcaagacgtacaagattgagtcctgggagaacgcggaggac
tttcttgagaagctagctctccgcactgggaagttactgaagggtggagagcctgacatg
ctgactgtgagcaagatggttctcaatgactggcagagaggccgaatccctttctttgtc
aagccgcccaatgcagagctaccgaccgattcccagcttccaccatcctcaccattggaa
gttcccacagaaacaacccagaacaacccagaagaagagaccacagaaacagaagttgaa
aggtcagactctatcactgaaaaggagccagaaggagactgttctcaggatagaaactca
gagatgcaacagatcctcgcacgagttcgccagaactttggcaaaatcaacgtggggcct
cagttttctgcggatgacctggtgcctgtggagatgtcagacttggaagatctggaaagc
tctggggaagaggaagaacaggagcaggaacagccaggggaggatgccgaggaagagcgc
tccccagacactcaggaggaaccagtgggaaacgacaccaaggccgtgctcagagccctg
gatgagaagattgccaagtaccagaggtttctaaataaagctaaagctaaaaagttctct
gccgtcagaatatccaaggacttaagtgaaaaggtttttgcaaaatacaaagaagagaag
aaaacatctgcagaagacagtgatgcagcacccaccaaaaaggcaaggaagtgggatgca
cagatggaagaagaaccttcaaataagactcagaggatgctgacgtgtaaggaacggagg
agagcagcacggcagcaacaatccaaaaaagttggtgtgcgttactacgagacacacaat
gtgaaaaacaggaacaggaacaaaaagaagacgagcgactcagagggacagaaacacaga
cgcaacaagttcagacagaagcagtaa

DBGET integrated database retrieval system